KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01250Help
Entry
BMULJ_01250       CDS       T00740                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00010  Glycolysis / Gluconeogenesis
bmj00620  Pyruvate metabolism
bmj00640  Propanoate metabolism
bmj00680  Methane metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_01250 (acs)
   00620 Pyruvate metabolism
    BMULJ_01250 (acs)
   00640 Propanoate metabolism
    BMULJ_01250 (acs)
  Energy metabolism
   00680 Methane metabolism
    BMULJ_01250 (acs)
Enzymes [BR:bmj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMULJ_01250 (acs)
Lipid biosynthesis proteins [BR:bmj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMULJ_01250 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAG43189
UniProt: A0A0H3KDN4
Position
1:complement(1334581..1336200)
Genome map
AA seq 539 aa AA seqDB search
MLPAADRYDDLLTHFRWAIPAHYNIGVDACDKWADGSGRLALIHETADGDVARFTFDDLR
NASNRLANAFARAGLRRGDRIAIFLAQGPETAVAHLAAYKLGAIAVPLFTLFGADALEYR
LANSEAAALVTDAAGYAKIAPLRDRLPALHTCYCIGADAADAPGVLRYDAALAAESPEFA
PADTAADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQQCFPRDARLFWTPADWA
WIGGLLDVLLPSWHHGVPVLARRLEKFDGDAAFALMARHGVTHAFLPPTALKLMRTVERP
RERYALSLKSVASGGESLGTELTEWGRDALGVTINEFYGQTECNMVLSSCAALFEARPGA
IGKAVPGHTVAIVDAHGTPLPPGVDGHIAVRRPDPVMFIEYWRNPDATRDKFAGDYLLTG
DTGAIDEDGFVRFVGRDDDVITSAGYRIGPGPIEDCLLTHPAVRMAAVVGVPDPTRTEIV
KAFVVLNDGHVGDDALVQALQAHVRTRLAAHEYPRAIAFVDSLPMTATGKIVRRALRDA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgccgccgatcgctacgacgacctgcttacccacttccggtgggcgattccg
gcgcactacaacatcggcgtggacgcatgcgacaaatgggcggacggcagcggccgcctc
gcgctgattcacgaaacggcggacggcgacgtcgcgcgcttcacgttcgacgacctgagg
aacgcctctaaccggctcgcgaacgcgttcgcgcgtgcggggctgcgccgcggcgaccgc
atcgcgatcttcctcgcgcagggcccggaaacggccgtcgcgcatctggccgcctacaag
ctcggcgcgatcgcggtgccgctgttcacgctgttcggcgccgatgcactcgaataccgt
ctcgcgaacagcgaagcggccgcgctcgtcaccgacgcggccggctacgcgaaaatcgcg
ccgctgcgcgatcggctgccggcgctgcatacctgctactgcatcggcgccgacgcggcc
gacgcgccgggcgtgctgcgctacgacgccgcactcgcggccgaatcgccggaattcgcg
ccggccgacacggccgccgacgatcctgcgctgatcatctacacgtcgggcacgaccggc
aagccgaaaggcgcactgcatgcgcatcgcgtgctgctcggccatctgccgggcgtcgag
atgtcgcagcaatgctttccgcgcgacgcgcggctgttctggacgcccgccgactgggcg
tggatcggcgggctgctcgacgtgctgctgccgtcgtggcatcacggcgtgccggtgctc
gcgcgccgcttggagaaattcgacggcgatgcggcgttcgcgctgatggcgcggcacggc
gtcacgcacgccttcctgccacccaccgcgctgaagctgatgcgcacggtcgaacggccg
cgcgagcgctacgcgctgtcgctgaaatccgtcgcgagcggcggcgaatcgctcggcacc
gagctcaccgaatgggggcgcgacgcgctcggcgtgacgatcaacgagttctacgggcag
accgaatgcaacatggtgctgtcgtcgtgcgcggcgctgttcgaggcacgacccggcgcg
atcggcaaggcggtgcccggtcacacggtcgcgatcgtcgacgcgcacggcacgccgctg
ccgcccggcgtcgacggacacatcgccgtgcgtcgccccgatcccgtgatgttcatcgaa
tactggcgcaacccggacgcgacgcgcgacaagttcgcaggcgactacctgctgaccggc
gacacgggcgcgatcgacgaggacggcttcgtgcgcttcgtcggccgcgacgacgacgta
atcacgagcgccggctaccggatcggccccggcccgatcgaggactgcctgctcacgcat
cccgccgtgcggatggcggccgtcgtcggcgtgcccgatccgacgcgcaccgagatcgtc
aaggcgttcgtcgtgctgaacgacggccatgtcggcgacgacgcgctcgtgcaggcgctg
caggcgcacgtgcgcacgcggcttgccgcgcacgagtatccgcgcgcgatcgcgttcgtc
gacagcctgccgatgacggcgacgggcaagatcgtgcgccgcgcgctgcgcgacgcgtga

DBGET integrated database retrieval system