KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01315Help
Entry
BMULJ_01315       CDS       T00740                                 

Gene name
egl
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMULJ_01315 (egl)
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BMULJ_01315 (egl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1413845..1415089
Genome map
AA seq 414 aa AA seqDB search
MAQAIATRCADSARRLGATFVLAVAAACVAGGTAARAATAPRTVGGAASATDAADARCAA
DWPRWDAFKRAFVSADGRVIDVGSADSRTVSEGQAYGLFFALVANDRRTFDTILAWTENN
LAQGDLSARLPAWLWGRAPDGTWRVLDANAASDADLWIAYTLVEAGRLWRERSYTARGTL
LAKRVLDDETANVPGLGLTLLPGPTGFALARDRWRVNPSYSPPQVIRALAVRLPDDRRWA
ALASSTGRVLLDTAPKGFAPDWALYRAGEGFGPDPQTHAESAYNAIRVYLWAGMLDRADP
LAAPLLARFAPFADYIAAHGAPPEKVDTTTGVAGPNDGNGGFSAAAVPFLDARGQHALAD
AQAARVDALARESAPGYYTSVLTLFGLGWREGRYRFGADGSLDVRWGERSCVAR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggcaatcgcaacgcggtgcgcggactcggcgcgccgcctcggcgcgacgttc
gtgctggccgtcgcggccgcgtgtgtggcaggcggcacggccgcgcgcgcggcgacggcg
ccgcgtacggtcggcggcgcggcaagcgcgacggacgctgccgacgcgcgctgcgccgcg
gactggccgcgctgggacgcgttcaagcgcgcattcgtgtcggccgacgggcgcgtgatc
gacgtcggttcggccgattcgcgcacggtatcggaggggcaggcgtatggattgttcttc
gcgctcgtcgcgaacgaccggcgcacgttcgacacgatcctcgcatggaccgaaaacaac
ctcgcgcagggcgatctgagcgcacggctgccggcgtggctgtggggccgcgcgccggac
ggcacgtggcgcgtgctcgacgcgaacgcggcgtccgatgccgatctgtggatcgcgtac
acgctcgtcgaagcggggcggctgtggcgcgagcgcagctacacggcgcgcggcacgctg
ctcgcgaagcgcgtgctcgacgacgagacggcgaacgtgccgggcctcgggctcacgctg
ctgccggggccgaccggcttcgcgctcgcgcgcgatcgatggcgcgtgaacccgagctat
tcgccgccgcaagtgattcgtgcgctcgccgtacggctgcccgacgaccgccgctgggcc
gcgcttgcgtcgagcaccggccgcgtgctgctcgataccgcgccgaagggtttcgcgccg
gactgggcgctgtatcgcgcgggcgagggcttcggtcccgatccgcagacgcacgcggaa
agcgcgtacaacgcgattcgcgtctatctgtgggccggcatgctcgatcgcgccgatccg
ctcgccgcgccgctgctcgcgcgcttcgcgccgttcgccgactacatcgccgcgcatggc
gcgccgcccgagaaagtcgacacgacgaccggtgtcgccgggccgaacgacggcaacggc
ggcttctccgcggccgcggtgccgtttctcgacgcgcgcggccagcatgcgctggccgat
gcgcaggcggcgcgcgtcgatgcgcttgcgcgcgagtcggcgccgggctattacacgagc
gtgctgacgctgttcggcctcggctggcgcgagggtcgctaccggttcggcgcggacggc
tcgctcgacgtgcgctggggagagcgttcgtgcgtcgcccgctga

DBGET integrated database retrieval system