KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01615Help
Entry
BMULJ_01615       CDS       T00740                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMULJ_01615 (rbsK)
Enzymes [BR:bmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BMULJ_01615 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1720926..1721858
Genome map
AA seq 310 aa AA seqDB search
MTAGAAARAGRVAVVGSLNMDLVVRAPRLPLPGETLAGHAFAQAAGGKGGNQAVAAARLG
AQVAMIGCVGADAHGAALRAGLEAEGIDCAGLATSASAPTGVALIVVDDGSQNAIVIVAG
GNGEVTPETVARHEATFASADVLICQLETPPDTVRAALAAGRRLGRTVVLNPAPAVAPLP
ADWLALVDYLIPNELEAAALTGRPVRDAADAEVAARALQARGARNVLITLGERGVLALTA
DGIARHYPAPVVRAVDTTAAGDTFIGGFAARLAAGAEVDAAIRFAQRAAALSVTRAGAQP
SIPTLAELGD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacggccggcgcggcagcgcgtgccggccgcgtcgcggtggtcggcagcctcaacatg
gatctcgtcgtgcgcgcgccgcggctgccgctgccgggcgagacgctcgcgggccacgcg
ttcgcgcaggcggcgggcggcaagggcggcaaccaggccgtcgcggcggcacggctcggc
gcgcaggtcgcgatgatcggctgcgtcggcgcggatgcgcatggcgccgcgctgcgcgcg
gggctcgaagccgaagggatcgactgcgcggggctcgcgacgagcgcgtccgcgccgacc
ggcgtcgcgctgatcgtcgtcgacgacggaagccagaacgcgatcgtgatcgtcgcgggc
ggcaacggcgaagtgacgccggagacggtcgcgcggcacgaggcgacgttcgcgtccgcc
gacgtgctgatctgccagctcgagacgccgcccgacacggtccgcgcggcgcttgccgcc
ggacgccggctcggccgcacggtcgtgctgaatccggcgccggccgtcgcgccgctgccg
gccgactggctcgcattggtcgactatctgataccgaacgaactggaagccgctgcgctg
accggccgcccggtgcgcgacgcagcggacgccgaagtcgcggcgcgtgcgctgcaggcg
cgcggcgcgcgcaacgtgctgatcacgctcggcgaacgcggcgtgctcgcgttgacggcc
gacggcatcgcgcgacactatccggcgccggtcgtgcgcgcggtcgacacgacggccgcc
ggcgacacgttcatcggcggttttgccgcgcggctcgcggccggcgccgaggtcgacgcg
gcaatccgtttcgcacagcgcgcggccgcgctgtcggtcacgcgggctggcgcccagccg
tccatcccgaccctcgccgaactcggcgactga

DBGET integrated database retrieval system