KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01662Help
Entry
BMULJ_01662       CDS       T00740                                 

Gene name
chlI
Definition
(RefSeq) magnesium chelatase subunit ChlI
  KO
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMULJ_01662 (chlI)
Enzymes [BR:bmj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BMULJ_01662 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1792018..1793100
Genome map
AA seq 360 aa AA seqDB search
MSDPATPRARAVFPFTALVAQDALQQALLLAAIDPSIGGVLVSGPRGTAKSTAARALAEL
LPEGAFVTLPLSATDEQVTGTLDLAHALAENGVRFRGGLLARAHRGVLYVDEVNLLADGL
VDTLLDVAASGVNVVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRARHADAQRTLAERIRAARARLPALQFDDAVHARVSALC
IDAAVDGLRADLVMLRAARALAALEAADAVTVAHVDRVAEAVLRHRRRADASPPSAARAP
DSRTAHDDATHRDTREHLPRDTAPSPDDAGASHGDWGYLPPASAGLRDVKAVVPLPLKKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccggccacgccccgcgcacgcgcggttttcccgtttacggcgctggtcgcg
caggacgcgctgcagcaggcgctgctgctcgccgcgatcgatccgtcgatcggcggcgtg
ctcgtcagcgggccgcgcggcaccgcgaaatccaccgccgcgcgggcgctcgccgagctg
ctgccggaaggcgcgttcgtcacgttgccgctgtcggccaccgacgagcaggtcaccggc
acgctcgatctcgcgcatgcgctcgcggagaacggcgtgcgctttcgcggcggtctgctg
gcgcgtgcgcatcgcggcgtgctctacgtcgacgaggtgaacctgctcgccgacggcctc
gtcgatacgctgctcgacgtcgcggcgagcggcgtgaacgtcgtcgagcgcgatggcgtg
tcgcacgcgcatgatgcgcgcttcgtgctggtcggcacgatgaatccggaagagggcgag
ctgcgtccgcagctgctcgaccgcttcgggctcatggtcgagctcgagaactgcttcgat
gccgcgcagcgcgaacggatcgtgaaggcgcgcctcgcgttcgatctcgatcccgacgcg
tttcgcgcccggcacgcggatgcgcagcgaacgctcgccgagcggatccgcgcggcgcgt
gcacggctgccggcactgcaattcgacgatgccgtgcatgcgcgcgtaagcgcgctctgc
atcgacgcggccgtcgacggattgcgcgccgatctcgtgatgttgcgcgcggcgcgtgcg
cttgccgcgctggaagcagccgacgcggtgacggtcgcgcacgtcgaccgcgtcgcggaa
gcggtgcttcggcatcggcgccgcgcggacgcatcgccgccgtcggctgcgcgcgcgccc
gattcgcgcacggcgcacgacgatgcgacgcatcgcgacacgcgcgagcacctgccgcgc
gacacggcgccgtcgcccgacgacgcgggcgcatcgcacggcgactggggctacctgccg
ccggcgtccgcggggctgcgcgacgtgaaggccgtcgtgccgctgccgctaaaaaaacgc
tga

DBGET integrated database retrieval system