KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01662Help
Entry
BMULJ_01662       CDS       T00740                                 

Gene name
chlI
Definition
magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bmj00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1792018..1793100
Genome map
AA seq 360 aa AA seqDB search
MSDPATPRARAVFPFTALVAQDALQQALLLAAIDPSIGGVLVSGPRGTAKSTAARALAEL
LPEGAFVTLPLSATDEQVTGTLDLAHALAENGVRFRGGLLARAHRGVLYVDEVNLLADGL
VDTLLDVAASGVNVVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRARHADAQRTLAERIRAARARLPALQFDDAVHARVSALC
IDAAVDGLRADLVMLRAARALAALEAADAVTVAHVDRVAEAVLRHRRRADASPPSAARAP
DSRTAHDDATHRDTREHLPRDTAPSPDDAGASHGDWGYLPPASAGLRDVKAVVPLPLKKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccggccacgccccgcgcacgcgcggttttcccgtttacggcgctggtcgcg
caggacgcgctgcagcaggcgctgctgctcgccgcgatcgatccgtcgatcggcggcgtg
ctcgtcagcgggccgcgcggcaccgcgaaatccaccgccgcgcgggcgctcgccgagctg
ctgccggaaggcgcgttcgtcacgttgccgctgtcggccaccgacgagcaggtcaccggc
acgctcgatctcgcgcatgcgctcgcggagaacggcgtgcgctttcgcggcggtctgctg
gcgcgtgcgcatcgcggcgtgctctacgtcgacgaggtgaacctgctcgccgacggcctc
gtcgatacgctgctcgacgtcgcggcgagcggcgtgaacgtcgtcgagcgcgatggcgtg
tcgcacgcgcatgatgcgcgcttcgtgctggtcggcacgatgaatccggaagagggcgag
ctgcgtccgcagctgctcgaccgcttcgggctcatggtcgagctcgagaactgcttcgat
gccgcgcagcgcgaacggatcgtgaaggcgcgcctcgcgttcgatctcgatcccgacgcg
tttcgcgcccggcacgcggatgcgcagcgaacgctcgccgagcggatccgcgcggcgcgt
gcacggctgccggcactgcaattcgacgatgccgtgcatgcgcgcgtaagcgcgctctgc
atcgacgcggccgtcgacggattgcgcgccgatctcgtgatgttgcgcgcggcgcgtgcg
cttgccgcgctggaagcagccgacgcggtgacggtcgcgcacgtcgaccgcgtcgcggaa
gcggtgcttcggcatcggcgccgcgcggacgcatcgccgccgtcggctgcgcgcgcgccc
gattcgcgcacggcgcacgacgatgcgacgcatcgcgacacgcgcgagcacctgccgcgc
gacacggcgccgtcgcccgacgacgcgggcgcatcgcacggcgactggggctacctgccg
ccggcgtccgcggggctgcgcgacgtgaaggccgtcgtgccgctgccgctaaaaaaacgc
tga

DBGET integrated database retrieval system