KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01662Help
Entry
BMULJ_01662       CDS       T00740                                 

Gene name
chlI
Definition
(GenBank) magnesium chelatase subunit ChlI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00860  Porphyrin and chlorophyll metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMULJ_01662 (chlI)
Enzymes [BR:bmj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BMULJ_01662 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM Sigma54_activat AAA AAA_22 AAA_16 AAA_30
Motif
Other DBs
NCBI-ProteinID: BAG43583
UniProt: A0A0H3KEQ4
Position
1:1792018..1793100
Genome map
AA seq 360 aa AA seqDB search
MSDPATPRARAVFPFTALVAQDALQQALLLAAIDPSIGGVLVSGPRGTAKSTAARALAEL
LPEGAFVTLPLSATDEQVTGTLDLAHALAENGVRFRGGLLARAHRGVLYVDEVNLLADGL
VDTLLDVAASGVNVVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRARHADAQRTLAERIRAARARLPALQFDDAVHARVSALC
IDAAVDGLRADLVMLRAARALAALEAADAVTVAHVDRVAEAVLRHRRRADASPPSAARAP
DSRTAHDDATHRDTREHLPRDTAPSPDDAGASHGDWGYLPPASAGLRDVKAVVPLPLKKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccggccacgccccgcgcacgcgcggttttcccgtttacggcgctggtcgcg
caggacgcgctgcagcaggcgctgctgctcgccgcgatcgatccgtcgatcggcggcgtg
ctcgtcagcgggccgcgcggcaccgcgaaatccaccgccgcgcgggcgctcgccgagctg
ctgccggaaggcgcgttcgtcacgttgccgctgtcggccaccgacgagcaggtcaccggc
acgctcgatctcgcgcatgcgctcgcggagaacggcgtgcgctttcgcggcggtctgctg
gcgcgtgcgcatcgcggcgtgctctacgtcgacgaggtgaacctgctcgccgacggcctc
gtcgatacgctgctcgacgtcgcggcgagcggcgtgaacgtcgtcgagcgcgatggcgtg
tcgcacgcgcatgatgcgcgcttcgtgctggtcggcacgatgaatccggaagagggcgag
ctgcgtccgcagctgctcgaccgcttcgggctcatggtcgagctcgagaactgcttcgat
gccgcgcagcgcgaacggatcgtgaaggcgcgcctcgcgttcgatctcgatcccgacgcg
tttcgcgcccggcacgcggatgcgcagcgaacgctcgccgagcggatccgcgcggcgcgt
gcacggctgccggcactgcaattcgacgatgccgtgcatgcgcgcgtaagcgcgctctgc
atcgacgcggccgtcgacggattgcgcgccgatctcgtgatgttgcgcgcggcgcgtgcg
cttgccgcgctggaagcagccgacgcggtgacggtcgcgcacgtcgaccgcgtcgcggaa
gcggtgcttcggcatcggcgccgcgcggacgcatcgccgccgtcggctgcgcgcgcgccc
gattcgcgcacggcgcacgacgatgcgacgcatcgcgacacgcgcgagcacctgccgcgc
gacacggcgccgtcgcccgacgacgcgggcgcatcgcacggcgactggggctacctgccg
ccggcgtccgcggggctgcgcgacgtgaaggccgtcgtgccgctgccgctaaaaaaacgc
tga

DBGET integrated database retrieval system