KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01740Help
Entry
BMULJ_01740       CDS       T00740                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00010  Glycolysis / Gluconeogenesis
bmj00071  Fatty acid degradation
bmj00350  Tyrosine metabolism
bmj00625  Chloroalkane and chloroalkene degradation
bmj00626  Naphthalene degradation
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_01740 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    BMULJ_01740 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMULJ_01740 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMULJ_01740 (adh)
   00626 Naphthalene degradation
    BMULJ_01740 (adh)
Enzymes [BR:bmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMULJ_01740 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 ELFV_dehydrog Methyltransf_25 2-Hacid_dh_C Methyltransf_11 Methyltransf_12 UDPG_MGDP_dh_N TPMT 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAG43660
UniProt: A0A0H3KJS1
Position
1:1869134..1870180
Genome map
AA seq 348 aa AA seqDB search
MKAVVYEAFGAAPRVMQVADPTPAPDGVVIEVKATGVCRSDWHGWMGHDPDIVLPHVPGH
ELAGVVVATGADVTRWKAGDRVTVPFVAGCGRCPECHSGNQQVCERQFQPGFTHWGSFAE
FVGIHHADLNLVRLPDSLDFPTAASLGCRFVTSFRAVVDQGRTSAGEWVAVHGCGGVGLS
AIMIANAIGANVVAVDISAAALARARAVGAAATVDASQVADVVDAVKDITGGGAHVSLDA
LGHPSTCFNSIANLRRRGRHVQVGLMLGEHATPAVPMSKVIAHELEILGSHGMQAHRYDA
MLDMVRAGKLAPSRLIGKETSLGESVEALMNMNRFEGAGVTVVTDFSH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagtcgtttacgaagcgttcggcgccgcgccgcgcgtgatgcaggtcgcggac
ccgacgcccgcgccggacggcgtcgtgatcgaggtgaaggcgaccggcgtctgccgcagc
gactggcacggctggatggggcacgatccggacatcgtgctgccgcacgtgccgggacac
gaactggcgggcgtggtcgtcgcgaccggtgcggacgtcacgcgctggaaggccggcgac
cgcgtgaccgtgccgttcgtcgccggctgcggccgctgccccgagtgtcattccggcaac
cagcaagtatgcgagcggcaatttcagccgggcttcacgcactggggttcgttcgccgaa
ttcgtcggcatccatcatgcggacctgaacctcgtgcggctgcccgactcgctcgatttt
ccgaccgcggcaagcctcggctgccggttcgtcacgtcgtttcgtgcggtcgtcgatcag
gggcgcacgtcggccggcgaatgggtcgcggtgcacggctgcggcggcgtcggattgtcg
gcgatcatgatcgcgaacgcgatcggcgcgaatgtcgtcgcagtcgacatttcggcggcc
gcgcttgcgcgcgcgcgcgcggtgggtgcggccgcgaccgtcgatgcgtcgcaggtcgcc
gacgtcgtcgatgcggtgaaggacattaccggcggcggcgcgcacgtgtcgctcgatgcg
ctgggccacccgagcacctgcttcaactcgattgcaaacttgcgtcgccgcggccggcac
gtgcaggtcgggctgatgctcggcgagcatgcgacgccggcggtgccgatgagcaaggtg
atcgcccacgagctcgagattctcggcagccacgggatgcaggcgcatcgctacgatgcc
atgctcgatatggtgcgcgccggcaagctggcgccgagccggttgatcggcaaggaaacc
agcctcggcgagtcggtcgaggcgctgatgaacatgaaccggttcgaaggcgccggtgtg
acggtcgtgacggatttttcgcactga

DBGET integrated database retrieval system