KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01792Help
Entry
BMULJ_01792       CDS       T00740                                 

Gene name
pcm
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
Enzymes [BR:bmj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BMULJ_01792 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1926567..1927496)
Genome map
AA seq 309 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKSDGRPGERHALAASKSADGPVAVPKPGAARGVPAGLAA
AKPATAPKATAPKPTLPKPAAPRPIAPSAAPAGAFALTSERVRERMVERLRANGVADARV
LAAMAAVPRHLFVDPGLATQAYEDSALPIGHQQTISKPSVVARMIELAMAGRSLERVLEI
GTGCGYQAAVLSHVARDVYSIERIKPLYERAKLNLRPLRVPNIRLHYGDGRVGLPSAAPF
DAIVIAAAGLDVPQALLEQLAIGGRLIAPVGAQSGQPQVLTLVERVAHAQWRESRLDRVF
FVPLKSGVI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggttcccgctcgcgctcgaagatctcaagcgagcgcca
cgcaaatccgacgggcggcccggcgaacgccatgcgctcgccgcatcgaagtccgccgac
ggtccggtcgccgtgccgaagcccggcgcggcgcgcggcgtgccggccggcctcgctgcc
gcgaagcccgcgacggcgccgaaggccaccgcaccgaagccgacgctgccgaagcctgcc
gcaccgcggccgatcgcaccgagcgcggcgccggccggcgcgttcgcgctcacctcggaa
cgcgtgcgcgagcgcatggtcgaacggttgcgtgcgaacggcgtcgccgacgcgcgcgtg
ctggcggcgatggcggcggtgccgcgccacctgttcgtggatcccggcctcgcgacgcag
gcctacgaggattccgcactgccgatcggccaccagcagaccatttcgaagccgtcggtc
gtcgcgcgcatgatcgagctcgcgatggccggccgctccctcgagcgcgtcctcgaaatc
ggcaccggctgcggctatcaggccgcggtgctgagccacgtggcgcgcgacgtgtattcg
attgaacgcatcaagccgctgtacgagcgcgcgaagctgaacctgaggccgctgcgcgtg
ccgaacatccgtctgcactacggcgacgggcgtgtcggcctgccgtccgccgccccgttc
gatgcgatcgtgatcgcagccgcggggctcgacgtgccgcaggcgctgctcgagcagctc
gcgatcggcgggcgcctcatcgcgccggtcggtgcgcagagcgggcagccgcaggtcctc
acgctcgtcgagcgcgtcgcgcacgcgcagtggcgggagtctcggcttgatcgcgttttc
tttgtccctttaaaatccggagtgatttga

DBGET integrated database retrieval system