KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01795Help
Entry
BMULJ_01795       CDS       T00740                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMULJ_01795 (recR)
DNA repair and recombination proteins [BR:bmj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BMULJ_01795 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1929614..1930210)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRALPGVGPKSAQRMAYHLMQHDREGAERLGRSLLFATEHLRHCDKC
NTFTEAQICEVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccgtccgccctgtccgcgctcgtcgaagcgctgcgcgcgctgcccggcgtc
gggccgaagtccgcgcagcgcatggcgtaccacctgatgcagcacgatcgggagggcgcg
gagcggctcggccggtcgttgctgttcgcgaccgagcatctgcggcactgcgataaatgc
aacacgttcaccgaagcgcagatctgcgaggtctgcagcgacgaggaacgcgacccgacg
ctgctgtgcgtcgtcgaaacgcctgccgatcaaatcatgctcgagcagacgatgacctat
cgcggcctgtacttcgtgctgatggggcggctcagtccgctcgacggcattggcccgaag
gaaatccacttcgaccggctcgtgcgccgcgcatccgacggcatcgtcaaggaagtcgtg
ctcgcgacgaacttcacgaacgaaggcgaggccaccgcgcattacctcggccagacgctg
aaggcgcgcgggctcgcggtcacgcgcctcgcgcgcggcgtgccggtcggcggcgagctc
gaatacgtcgacgcgggcacgatcgcccgcgcgatgctcgaccgccgcacgatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system