KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01807Help
Entry
BMULJ_01807       CDS       T00740                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00010  Glycolysis / Gluconeogenesis
bmj00020  Citrate cycle (TCA cycle)
bmj00620  Pyruvate metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01200  Carbon metabolism
Module
bmj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_01807 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BMULJ_01807 (pdhC)
   00620 Pyruvate metabolism
    BMULJ_01807 (pdhC)
Enzymes [BR:bmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMULJ_01807 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Abhydrolase_5 PGAP1 Esterase Ndr DUF900 Abhydrolase_3 Ser_hydrolase LIDHydrolase
Motif
Other DBs
NCBI-ProteinID: BAG43727
UniProt: A0A0H3KFB8
Position
1:complement(1943405..1944520)
Genome map
AA seq 371 aa AA seqDB search
MSIHMITMPKWGLSMEQGQVNGWLKSVGERVSKGDEVLDVETDKISSGVECAFDGTLRRQ
VAQEGETLPVGALLGVVAAADVSDADIDAAIAAFQRDYTPSAAADEAAGPQPEKAQIGGR
TMRFLKLGDGAGTPAVLIHGFGGDLNNWLFNHAELAAHRPVWALDLPGHGESGKAVERGS
LDELADAVLALLDAKDIERAHLIGHSMGGAVAMTVAERAPARVASLTLIASAGLGAEINR
DYIDGFVAGNSRNTLKPHLGALFADSALVTRQLVDDLVKYKRLEGVQAALEKIANAAFDG
ATQRRVFRDRLASLAPRTLVIWGERDQVIPAQHAHGLPDGVRTELIAGSGHMVQMEAAAD
VNRLIVAFLGD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcacatgatcacgatgcccaagtgggggctgtcgatggagcaggggcaggtc
aacggctggctgaagtcggtcggcgaacgcgtgtcgaagggcgacgaggtgctcgacgtc
gaaaccgacaagatctcgtcgggcgtcgaatgcgcattcgacggcacgctgcgccggcag
gtcgctcaggagggcgaaacgctgccggtcggggcgctgctcggcgtggtcgccgcggcc
gacgtgagcgatgccgacatcgacgcggcgatcgcggcattccagcgcgactacacgccg
agcgcggcggccgacgaagcggccggcccgcaaccggagaaggcgcagatcggcggccgc
acgatgcgcttcctgaagctcggcgacggcgccgggacgccggccgtgctgatccacggc
ttcggcggcgacctgaacaactggctgttcaatcatgcggaactggcggcgcaccggccg
gtgtgggcgctcgatctgcccggtcacggcgagtcgggcaaggcggtcgagcgcggcagc
ctcgacgagctcgccgacgccgtgctggcgctgctcgacgcgaaggacatcgaacgcgcg
cacctgatcggccattcgatgggcggcgcggtcgcgatgacggtcgccgagcgtgcgccg
gcgcgcgtcgcgtcgctgacgctgatcgcgagcgcgggcctcggtgccgagatcaaccgc
gactacatcgacggcttcgtcgccggcaacagccgcaatacgctgaagccgcatctcggc
gcgctgttcgcggacagcgcgctcgtcacgcgacagctcgtcgacgatctcgtcaaatac
aagcggctcgaaggcgtgcaggccgcgctcgagaagatcgcgaacgccgcgttcgacggc
gcgacgcagcggcgcgtgttccgcgaccggcttgcgtcgctcgcgccgcgcacgctcgtg
atctggggcgagcgcgaccaggtgattccggcgcagcacgcgcacggcttgccggacggc
gtgcgcaccgagctgatcgccggcagcgggcacatggtgcagatggaagcggcggccgac
gtgaaccggctgatcgtcgcgtttctcggagactga

DBGET integrated database retrieval system