KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01823Help
Entry
BMULJ_01823       CDS       T00740                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMULJ_01823 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMULJ_01823 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMULJ_01823 (thrC)
Enzymes [BR:bmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMULJ_01823 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1960018..1961469)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLAGLAKDGGLYLPAEYPQVSADELARWRALPYSDLAFEI
LSKFCDDVPADDLRAIARRTYTADVYRHTRHGENAADITPLKTLGTEHGAPLALLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGETLNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
KKMSAFQTAQMYSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAQHKIGTVNSINWAR
VVAQVVYYFKGYFAATRSNDERVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGAYRVRSAENTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVEDKG
GFDLAASGDFARVAEFGFVSGRSSHADRIATIRDVFSRYGTTIDTHTADGVKVAREQLDA
GVPMIVLETAQPIKFGETIREALEREPERPAAFDGLESLPQRFEVVKADAQQVKDFIAAH
TRA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctccacgcgcggcgccggcatcggcgagcgccacacgttctccgacatc
ctgctcgccggcctcgcgaaggacggcgggctctatctgccggccgagtatccgcaggtg
tcggccgacgagctcgcgcgctggcgcgcgctgccgtattcggatctcgcgttcgagatc
ctgtcgaagttctgcgacgacgtgccggccgacgatctgcgcgcgatcgcgcgccgcacc
tatacggccgacgtctaccgccacacgcgccacggcgaaaacgcggccgacatcacgccg
ctgaagacgctcggcaccgagcacggcgcgccgctcgcgctgctcgaactgtcgaacggg
ccgacgctcgcgttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacacg
ctcgcgaagcacggcgagacgctgaacatcctcggcgcgacgtccggcgacacgggcagc
gcggccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagacggcgcagatgtacagcctgcaggatccgaacatcttc
aacctcgcggtcgagggcgtgttcgacgactgccaggacatcgtgaaggcagtgtcgaac
gatcacgcgttcaaggcgcagcacaagatcggcacggtgaattcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtctactacttcaagggctatttcgcggccacgcgctcgaacgac
gagcgcgtgtcgttcacggtgccgtcgggcaacttcggcaacgtctgcgcgggccacatc
gcgcgcatgatggggctgccgatcgcgaagctcgtcgtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcgcgtaccgcgtgcgcagcgcggagaacacctatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaatttcgagcgcttcgtgttcgat
ctgctcggccgcgatccggcgcgcgtgatgcagctgttccgcgacgtcgaggacaagggc
ggcttcgatctggcggcaagcggcgatttcgcgcgcgtcgccgagttcggcttcgtgtcg
ggccgcagcagccacgccgaccgcatcgcgacgatccgcgacgtgttctcgcgctacggc
acgacgatcgatacgcatacggccgacggtgtgaaggtcgcgcgcgagcagctcgatgcc
ggcgtgccgatgatcgtgctcgagacggcgcagccgatcaagttcggcgagacgatccgc
gaggcgctcgaacgcgaacccgagcggcccgcggcgttcgacgggctcgagtcgctgccg
cagcgcttcgaggtcgtgaaggccgacgcgcagcaggtgaaggacttcatcgccgcgcac
acgcgcgcctga

DBGET integrated database retrieval system