KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01873Help
Entry
BMULJ_01873       CDS       T00740                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMULJ_01873 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BMULJ_01873 (fadA)
   00640 Propanoate metabolism
    BMULJ_01873 (fadA)
   00650 Butanoate metabolism
    BMULJ_01873 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    BMULJ_01873 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BMULJ_01873 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMULJ_01873 (fadA)
   00310 Lysine degradation
    BMULJ_01873 (fadA)
   00380 Tryptophan metabolism
    BMULJ_01873 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMULJ_01873 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMULJ_01873 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMULJ_01873 (fadA)
Enzymes [BR:bmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMULJ_01873 (fadA)
Exosome [BR:bmj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMULJ_01873 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(2011067..2012245)
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTPLAKSWRGAFNMTHGATLGGHVVAAALERAKLDPARVEDVIIGCANPE
GATGGNIARQIALRAGLPVSVPGMTVNRFCSSGLQTIALAAQRIIAGEGDVYVAGGVESI
SCVQNEMNRHMAYEGWLLEHKPEIYWTMLQTAENVAKRYGISKERQDEYGVNSQLKAAAA
QEAGRFRDEIVPITVRAGIADKATGRLFTKEVTVSADEGIRPDTTLDGVSKIRPAVPGGV
ITAGNASQFSDGAAACVVMSAAAAQREGLQPLGVFRGFAVAGCEPDEMGIGPVFAVPKLL
KQAGLGVDDIGLWELNEAFAVQVLYCRDTLGIPDDRLNVNGGAIAVGHPYGVSGTRLTGH
ALIEGKRRGVKYAVVTMCIGGGQGAAGLFEIV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcacgcacgccgctcgcgaaatcgtggcgcggc
gccttcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggcggcgctcgag
cgcgcgaagctcgacccggcgcgcgtcgaggacgtgatcatcggctgtgcgaatccggaa
ggcgcgacgggcggcaatatcgcgcggcagatcgcattgcgtgcggggctgccggtcagc
gtgccgggcatgacggtgaaccgcttctgctcgtcggggttgcagacgatcgcactcgcc
gcccagcgcatcatcgcgggcgagggcgacgtctacgtcgcgggcggcgtcgagtcgatc
tcgtgcgtgcagaacgagatgaaccggcacatggcgtacgagggctggctgctcgaacac
aagccggaaatctactggacgatgctgcagacggccgagaacgtcgcgaagcgctacggg
atctcgaaggagcgtcaggacgaatacggcgtgaactcgcagctcaaggccgctgccgcg
caggaagcgggacgctttcgcgacgagatcgtgccgatcaccgtgcgcgccggcatcgcg
gacaaggccaccggccgcctgttcacgaaggaagtgacggtgtcggccgacgaggggatc
cgtccggacacgacgctcgacggcgtgtcgaagattcgtccggccgtgccgggcggcgtg
atcacggccggcaatgcgagccagttttccgacggcgcggccgcgtgcgtcgtgatgagc
gccgcggccgcgcagcgcgaagggctgcagccgctcggcgtgttccgcggcttcgcggtg
gccggctgcgagccggacgagatgggcatcggccccgtgttcgcggtgccgaagctgctg
aagcaggcagggctcggcgtcgacgacatcgggctctgggagctgaacgaagcgtttgcg
gtgcaggtgctctattgccgcgacacgctcgggatccctgacgatcgcctgaacgtgaac
ggtggcgcaatcgcggtcggccacccgtacggcgtgtcgggcacgcggctgaccggccac
gcgctgatcgaaggcaagcggcgcggcgtcaagtatgcggtcgtcacgatgtgcatcggc
ggcgggcagggcgcggccggcctgttcgaaatcgtctga

DBGET integrated database retrieval system