KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01874Help
Entry
BMULJ_01874       CDS       T00740                                 

Gene name
pncA
Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bmj00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2012298..2012930)
Genome map
AA seq 210 aa AA seqDB search
MKRTDDVLLVIDVQYDFMPGGALAVADGDAVVPVINALAQRFERVVITQDWHPREHVSFA
ANHPDGEPFSTIALPYGEQVLWPVHCVQDTEGAALHRDLDLPHAQLVIRKGCDARVDSYS
AFVEADRTTRTGLAGYLREIGAKRVWCCGLATDYCVAWSALDARAAGFDAAVIDDACRAI
DLNGSLAQAWQQMQAAGVARVTSDGVRASA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaccgacgacgtcctgctcgtgatcgacgtgcagtacgacttcatgccgggc
ggcgcgctggccgtcgccgacggcgacgcggtcgtgcccgtgatcaacgcgctcgcgcag
cggttcgagcgcgtcgtgatcacgcaggactggcatccgcgcgagcacgtgtcgttcgcg
gcgaatcatccggacggcgaaccgttctcgacgatcgcgctgccgtacggcgagcaggtg
ctgtggcccgtgcactgcgtgcaggacaccgaaggcgcggcgctgcatcgcgacctcgac
ctgccgcacgcgcagctcgtgattcgcaagggctgcgatgcgcgcgtcgacagctattcc
gcattcgtcgaagccgatcgcacgacgcgcacggggctcgccggctatctgcgcgagatc
ggcgcgaaacgcgtctggtgctgcgggctcgcgaccgactattgcgtcgcgtggtcggcg
ctcgacgcgcgcgcggcgggcttcgacgccgcggtgatcgacgatgcgtgccgcgcgatc
gacctgaacggctcgctcgcgcaggcatggcagcagatgcaggcggcgggcgtcgcacgc
gtgacgtccgatggcgtgcgcgccagcgcatag

DBGET integrated database retrieval system