KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01888Help
Entry
BMULJ_01888       CDS       T00740                                 

Definition
esterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BMULJ_01888
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BMULJ_01888
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BMULJ_01888
Lipid biosynthesis proteins [BR:bmj01004]
 Fatty acid synthase
  Component type
   BMULJ_01888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2031313..2031987
Genome map
AA seq 224 aa AA seqDB search
MDRTLRWKRRAALVALLGGTLAATGFARAAAAPAATAGQPVIAVLGDSLSAEYGLPRDTG
WVALLRQRLATERIDYSVANASVSGDTTSGGRARLPAVLQRLKPSIVVVELGANDALRGV
PLATTEQNLRDIVADARRAHAKVVLVGMYVPSNYGPDYTQKFHAVYTRLAKELDVPLVPF
LLAGIENKPDMFQSDQIHPTQQAQRVLLDNVWPTLKPLLGKPRG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggacaggacacttcgctggaaaagacgcgcggcgctcgtcgcgctgctgggcggcacg
ctcgccgcgacgggattcgctcgcgccgccgcggcaccggccgcgaccgcgggacagccg
gtgatcgccgtactcggcgacagcctctcggccgaatacgggctgccgcgcgacaccggc
tgggtcgcgctgctgcggcaacggctcgcgacggagcgaatcgattatagcgtcgcgaat
gcgagcgtcagcggcgacaccacgagcggcggccgcgcacggctgccggccgtgctgcag
cggctcaagccgtcgatcgtcgtcgtcgagctcggcgcgaacgacgcactgcgcggcgtg
ccgctcgcgacgaccgagcagaatctgcgcgacatcgtcgccgatgcgcggcgcgcgcac
gccaaagtcgtgctggtcggcatgtacgtgccgtcgaattacggccccgactacacgcag
aagttccatgcggtctatacgcgactggcgaaggaactcgacgtgccgctcgtgccgttc
ctgctcgccggcatcgagaacaagcccgacatgttccagtccgaccagatccatccgacg
cagcaggcgcagcgcgtgctgctcgacaacgtgtggccgacgctgaagccgctgctcggc
aagccgcgcggctga

DBGET integrated database retrieval system