KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02002Help
Entry
BMULJ_02002       CDS       T00740                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00300  Lysine biosynthesis
bmj01100  Metabolic pathways
bmj01120  Microbial metabolism in diverse environments
bmj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BMULJ_02002 (dapE)
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BMULJ_02002 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: BAG43919
UniProt: A9AHS8
Position
1:2155377..2156516
Genome map
AA seq 379 aa AA seqDB search
MSATLALTEQLIARASVTPDDQHCQQIMTERLAALGFDCETVASHGVTNLWAVKRGTDGR
DGKLLAFAGHTDVVPTGPLEQWTSPPFVPAHRDGKLYGRGAADMKTSLAAFVVAAEEFVA
AHPDHRGAIAFLITSDEEGPATDGTVKVVELLESRGERLDYCIVGEPTSTAELGDVVKNG
RRGSMSGELIVKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDEGNEYFPPTTWQVSNL
RAGTGATNVIPGHADLLFNFRFSTASTVEGLQARVHAILDKHQLDYTLKWTVSGLPFLTP
RGELSNALEHAIRAETGLTTELSTTGGTSDGRFIARICPQVIEFGPPNGSIHKIDEHIEV
RFVEPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaccctagcccttaccgaacaactgatcgcgcgcgcctccgtcacgcccgac
gaccagcattgccagcagatcatgaccgagcgcctcgccgcgctcggtttcgattgcgag
accgtcgcgtcgcacggcgtgaccaacctgtgggccgtcaagcgcggcaccgacggccgc
gacggcaagctgctcgcgttcgcgggccacaccgacgtcgtgccgaccggtccgctcgag
caatggacgtcgccgccgttcgtccccgcccatcgcgacggcaagctgtacggccgcggc
gccgccgacatgaagacctcgctcgcggcgttcgtcgtcgccgccgaggaattcgtcgcc
gcgcatcccgaccaccgcggcgcgatcgcgttcctgatcacgagcgacgaggaaggcccg
gccaccgacggcaccgtgaaggtcgtcgaactgctcgaatcgcgcggcgagcgtctcgac
tactgcatcgtcggcgagccgacgtcgaccgccgagctcggcgacgtcgtgaagaacggg
cgccgcggctcgatgtccggcgagctgatcgtcaagggcgtgcaaggccacatcgcgtat
ccgcatctcgcgaagaacccgatccacctgctcgcgccggcgctcgccgaactcgccgcc
gagcagtgggacgaaggcaacgagtacttcccgccgaccacctggcaggtgtcgaacctg
cgtgccggcacgggcgcgacgaacgtgatccccggccacgcggatctgctgttcaacttc
cgcttctcgaccgcgagcaccgtcgaaggcctgcaggcacgcgtgcacgcgatcctcgac
aagcaccagctcgactacacgctgaagtggacggtgagcggcctgccgtttctcacgccg
cgcggcgagctgtcgaatgcgctcgagcacgcgatccgcgcggagacgggcctcacgacc
gagctgtcgacgacgggcggcacgtccgacggccgtttcatcgcgcgcatctgcccgcag
gtgatcgagttcggtccgccgaacggcagcatccacaagatcgacgagcatatcgaggtg
cgcttcgtcgagccgctgaagaacgtgtatcgccgcgtgcttgaacaactgatcgcctga

DBGET integrated database retrieval system