KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02018Help
Entry
BMULJ_02018       CDS       T00740                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMULJ_02018 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMULJ_02018 (aceA)
Enzymes [BR:bmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BMULJ_02018 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2172914..2174221
Genome map
AA seq 435 aa AA seqDB search
MSRQQQAQELQKQWETDPRWKGIKRSYTAEDVVRLRGSIQVEHTLAKRGAEKLWELINNE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLSAARLAADVMGTPTVLVARTDAEAADLITS
DIDDNDKPFLTGERTVEGFFRTKPGLEQAVSRGLAYAPYADLIWCETGKPDLEYAKKFAE
AIHKQFPGKLLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARTQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtcagcaacaggcacaggaactgcaaaagcaatgggaaaccgatccgcgctgg
aagggcatcaagcgcagctacacggctgaagacgtggtgcgcctgcgcggctcgatccag
gtcgaacacacgctcgcgaagcgcggcgccgaaaagctgtgggagctgatcaacaacgag
ccgttcgtcaacgcgctcggcgcgctgaccggcaaccaggcgatgcagcaggtcaaggcc
ggcctgaaggcgatctacctgtccggctggcaggtcgcgggcgacgcgaacgtcgccggc
gagatgtatccggaccagtcgctgtatccggcgaactcggtgccgctcgtcgtgaagcgc
atcaacaacacgctgacgcgcgcagaccagatccagtggtccgaaggcaagaacccgggc
gacgaaggctatgtcgacttcttcgcgccgatcgtcgccgacgcggaagccggtttcggc
ggcgtgctgaacgcattcgagctgatgaaggcgatgatcgaggcaggcgcatcgggcgtg
cacttcgaagaccagctcgcatcggtcaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacgcgcgaagcggtcgcgaagctctcggccgcgcgtctcgccgccgacgtgatg
ggcacgccgaccgtgctcgtcgcacgtaccgacgcggaagccgcagacctgatcacgtcc
gacatcgacgacaacgacaagccgttcctgaccggcgagcgcacggtcgaaggcttcttc
cgcaccaagccgggcctcgagcaggccgtgtcgcgcggcctcgcgtatgcgccgtacgcc
gatctgatctggtgcgaaaccggcaagccggatctcgaatacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggagctcggcgcgatg
ggctataagttccagttcatcacgctcgccggcttccacgcgctgaactactcgatgttc
aacctcgcgcacggctatgcacgcacgcagatgagcgcgttcgtcgagctgcagcaggcc
gagttcgcggcagccgacaagggcttcacggcggtcaagcaccagcgcgaagtcggtacc
ggctacttcgacgcggtcacgcagacggtcgagcgcgaagcgtcgacgactgccctgcac
ggctcgaccgaagacgagcagttcttcgacggcaagaaggtcgcgtaa

DBGET integrated database retrieval system