KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02022Help
Entry
BMULJ_02022       CDS       T00740                                 

Gene name
glcB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMULJ_02022 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMULJ_02022 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMULJ_02022 (glcB)
Enzymes [BR:bmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BMULJ_02022 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2176897..2178489
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGLAITGEIKPGYEAILTPDALELVAALHRAFEPRRQALLQARVERTKRLDA
GERPDFLPETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKIATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEAIGIPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANEKAMAGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVQVEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLEDGRKVTAELV
REFAKAELENVKRSVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcttggcgatcaccggcgagatcaagccgggt
tacgaagcgatcctgacgcccgacgcgctcgagctcgtcgctgcgctgcatcgcgcgttc
gaaccgcgccgccaggcgctgctgcaggcgcgcgtcgagcgcacgaagcgtctcgacgcc
ggcgagcgccccgattttctgcccgagacgaaggccatccgcgaaggcgactggaaggtc
gcaccgctgccggccgacctgcagtgccgccgcgtcgagatcaccggccccgtcgagcgc
aagatgatcatcaatgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaatcagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtacaagctgaacgacaagatcgcg
acgctaatcgtgcgtccgcgcggctggcacctcgacgagaagcacgtgacggtcgacggc
cagcgtgtgtccggcggcatcttcgatttcgcgctgttcctgttccataacgcgaaggag
ctgatcgcgcgcggttcgggcccgtacttctacctgccgaagatggaaagccacctcgag
gcgcgcctgtggaacgacatcttcgtcgccgcgcaggaagcgatcggcattccgcgcggc
acgatccgcgcgacggtgctgatcgagacgatcctcgccgcgttcgaaatggacgagatc
ctctacgagctgcgcgaacacagctcgggcctgaacgcgggccgctgggactacattttc
tcggcgatcaagaagttcaagaacgatcgcgacttctgcctcgccgatcgttcgaagatc
acgatgacggtgccgttcatgcgcgcctacgcgctgctgctgctgaagacctgccacaag
cgcaatgcgccggcgatcggcgggatgagcgcgctgattccgatcaagaacgatccggaa
gcgaacgagaaggcgatggccggcgtgcgttcggacaagcagcgcgatgcgacggacggc
tacgacggcggctgggtggcgcatccgggcctcgtgccgatcgcgatggaggaattcgtc
aaggtgctcggcgacaagccgaaccagatcggcaagcagcgcgacgacgtgcaggtcgag
ggcaagaacctgctcgacttccagcccgaggcgccgatcaccgaagcgggcctgcgcaac
aacatcaacgtcgggatccactatctcggcgcgtggctcgacggcaacggctgcgtgccg
attcacaacctgatggaagatgcggccaccgccgagatctcgcgctcgcaggtgtggcag
tggatccgctcgccgaagggcgtgctcgaggacggccgcaaggtcaccgcggaactcgtg
cgcgagttcgcgaaggccgagctcgagaacgtgaagcgctcggtcggcggcaacacgcag
ccttacgagcgtgcggcggcgatcttcgaacagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system