KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02022Help
Entry
BMULJ_02022       CDS       T00740                                 

Gene name
glcB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00620  Pyruvate metabolism
bmj00630  Glyoxylate and dicarboxylate metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMULJ_02022 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMULJ_02022 (glcB)
Enzymes [BR:bmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BMULJ_02022 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: BAG43939
UniProt: A0A0H3KPM1
Position
1:2176897..2178489
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGLAITGEIKPGYEAILTPDALELVAALHRAFEPRRQALLQARVERTKRLDA
GERPDFLPETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKIATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEAIGIPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANEKAMAGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVQVEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLEDGRKVTAELV
REFAKAELENVKRSVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcttggcgatcaccggcgagatcaagccgggt
tacgaagcgatcctgacgcccgacgcgctcgagctcgtcgctgcgctgcatcgcgcgttc
gaaccgcgccgccaggcgctgctgcaggcgcgcgtcgagcgcacgaagcgtctcgacgcc
ggcgagcgccccgattttctgcccgagacgaaggccatccgcgaaggcgactggaaggtc
gcaccgctgccggccgacctgcagtgccgccgcgtcgagatcaccggccccgtcgagcgc
aagatgatcatcaatgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaatcagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtacaagctgaacgacaagatcgcg
acgctaatcgtgcgtccgcgcggctggcacctcgacgagaagcacgtgacggtcgacggc
cagcgtgtgtccggcggcatcttcgatttcgcgctgttcctgttccataacgcgaaggag
ctgatcgcgcgcggttcgggcccgtacttctacctgccgaagatggaaagccacctcgag
gcgcgcctgtggaacgacatcttcgtcgccgcgcaggaagcgatcggcattccgcgcggc
acgatccgcgcgacggtgctgatcgagacgatcctcgccgcgttcgaaatggacgagatc
ctctacgagctgcgcgaacacagctcgggcctgaacgcgggccgctgggactacattttc
tcggcgatcaagaagttcaagaacgatcgcgacttctgcctcgccgatcgttcgaagatc
acgatgacggtgccgttcatgcgcgcctacgcgctgctgctgctgaagacctgccacaag
cgcaatgcgccggcgatcggcgggatgagcgcgctgattccgatcaagaacgatccggaa
gcgaacgagaaggcgatggccggcgtgcgttcggacaagcagcgcgatgcgacggacggc
tacgacggcggctgggtggcgcatccgggcctcgtgccgatcgcgatggaggaattcgtc
aaggtgctcggcgacaagccgaaccagatcggcaagcagcgcgacgacgtgcaggtcgag
ggcaagaacctgctcgacttccagcccgaggcgccgatcaccgaagcgggcctgcgcaac
aacatcaacgtcgggatccactatctcggcgcgtggctcgacggcaacggctgcgtgccg
attcacaacctgatggaagatgcggccaccgccgagatctcgcgctcgcaggtgtggcag
tggatccgctcgccgaagggcgtgctcgaggacggccgcaaggtcaccgcggaactcgtg
cgcgagttcgcgaaggccgagctcgagaacgtgaagcgctcggtcggcggcaacacgcag
ccttacgagcgtgcggcggcgatcttcgaacagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system