KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02605Help
Entry
BMULJ_02605       CDS       T00740                                 

Gene name
sucD
Definition
succinyl-CoA synthetase subunit alpha (EC:6.2.1.5)
Orthology
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMULJ_02605 (sucD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMULJ_02605 (sucD)
   00640 Propanoate metabolism
    BMULJ_02605 (sucD)
   00660 C5-Branched dibasic acid metabolism
    BMULJ_02605 (sucD)
Enzymes [BR:bmj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BMULJ_02605 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2805666..2806547)
Genome map
AA seq 293 aa AA seqDB search
MSILINKDTKVITQGITGKTGQFHTRACREYANGREAFVAGVNPKKAGEDFEGIPIYASV
KEAKEETGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIPVRDMIEVKDRMRREGR
KTLLLGPNCPGTITPDELKIGIMPGHIHRKGRIGVVSRSGTLTYEAVAQLTALGLGQSSA
VGIGGDPINGLKHIDVMKMFNDDPDTDAVVMIGEIGGPDEANAAQWIKDNMKKPVVGFIA
GVTAPPGKRMGHAGALISGGADTAEAKLEIMEACGIKVTRNPSEMGRLLKAAL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattctgatcaacaaggacacgaaggtcatcacgcagggcattaccggcaagacc
ggtcagttccacacgcgcgcctgccgtgaatatgcaaacggccgcgaagcattcgtcgcg
ggcgtgaacccgaagaaggccggcgaagatttcgaaggcattccgatctacgcgagcgtc
aaggaagcgaaggaagaaaccggcgcgaccgtgtcggtcatctacgttccgccggcaggc
gctgctgctgcgatctgggaagcggtcgaagccgatctcgatctcgcgatctgcatcacg
gaaggcattcccgtgcgcgacatgatcgaagtgaaggaccgcatgcgtcgcgaaggccgc
aagacgctgctgctcgggccgaactgcccgggcacgatcacgccggacgagctgaagatc
ggcatcatgccgggtcacatccaccgcaagggccgcatcggcgtcgtgtcgcgttcgggc
acgctgacgtatgaagccgtcgcgcagctcaccgcgctcggccttggccagtcgtcggca
gtcggtatcggcggcgacccgatcaatggtctgaagcacatcgacgtcatgaagatgttc
aacgacgatccggatacggatgcggtcgtgatgatcggcgaaatcggcggtccggacgaa
gcgaacgccgcgcagtggatcaaggacaacatgaagaagccggtcgtcggcttcatcgcg
ggcgtcacggcgcctccgggcaagcgcatgggccacgccggcgcgctgatctcgggcggt
gcggatacggccgaagcgaagctggaaatcatggaagcctgcggcatcaaggtcacgcgc
aacccgtcggaaatgggccgcctgctgaaggcagcgctgtaa

DBGET integrated database retrieval system