KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02861Help
Entry
BMULJ_02861       CDS       T00740                                 

Gene name
paaG
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00071  Fatty acid degradation
bmj00280  Valine, leucine and isoleucine degradation
bmj00281  Geraniol degradation
bmj00310  Lysine degradation
bmj00360  Phenylalanine metabolism
bmj00362  Benzoate degradation
bmj00380  Tryptophan metabolism
bmj00410  beta-Alanine metabolism
bmj00627  Aminobenzoate degradation
bmj00640  Propanoate metabolism
bmj00650  Butanoate metabolism
bmj00903  Limonene and pinene degradation
bmj00930  Caprolactam degradation
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01212  Fatty acid metabolism
Module
bmj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMULJ_02861 (paaG)
   00650 Butanoate metabolism
    BMULJ_02861 (paaG)
  Lipid metabolism
   00071 Fatty acid degradation
    BMULJ_02861 (paaG)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMULJ_02861 (paaG)
   00310 Lysine degradation
    BMULJ_02861 (paaG)
   00360 Phenylalanine metabolism
    BMULJ_02861 (paaG)
   00380 Tryptophan metabolism
    BMULJ_02861 (paaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMULJ_02861 (paaG)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMULJ_02861 (paaG)
   00281 Geraniol degradation
    BMULJ_02861 (paaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMULJ_02861 (paaG)
   00627 Aminobenzoate degradation
    BMULJ_02861 (paaG)
   00930 Caprolactam degradation
    BMULJ_02861 (paaG)
Enzymes [BR:bmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMULJ_02861 (paaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 TAF
Motif
Other DBs
NCBI-ProteinID: BAG44749
UniProt: A0A0H3KMI5
Position
1:complement(3089290..3090117)
Genome map
AA seq 275 aa AA seqDB search
MADLAAYGGYQALKVTRREHGVLDIVMSGEGANRSGLATANAQMHRELADIWRDVDRDPD
TRVAVIRGEGKGFSAGGDLALVEAMANDYDVRARVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADISIAAKDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLMLCEP
VSGEEAERIGLVSLAVEPADLLPKAYEVAERLANGSQSAIRWTKYALNNWLRTAGPTFDT
SLALEFMGFSGPDVQEGLRSLRERRPPAFPGDAPF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccgatctcgccgcgtacggcggttatcaagcattgaaggtgacgcgccgcgaacac
ggcgtgctcgacatcgtgatgagcggcgagggcgcgaatcgcagcggtctcgcgacggcg
aacgcgcagatgcatcgcgagctcgcggacatctggcgcgacgtcgatcgcgatcccgac
acgcgcgtcgccgtgattcgcggcgaaggcaagggcttctcggcgggcggcgatctcgcg
ctcgtcgaagcgatggccaacgactacgacgtgcgcgcccgcgtgtggcgcgaagcgcgc
gacctcgtctacaacgtgatcaactgcagcaagccgatcgtgtccgcgatgcacggcccg
gcggtcggcgcggggctcgtcgcgggcctgctcgccgacatctcgatcgccgcgaaggat
gcgcggatcatcgacggccatacgcggctcggcgtcgcggccggcgatcacgcggcgatc
gtctggccgctgctgtgcgggatggcgaaggcgaagtactacctgatgctctgcgagccc
gtgagcggcgaagaggcggagcgcatcggcctcgtgtcgctcgcggtcgagccggccgat
ctgttgccgaaggcctacgaagtggccgagcggctcgcgaacgggtcgcagtcggcgatc
cgctggacgaagtacgcgctcaacaactggctgcgcacggccgggccgaccttcgatacg
tcgctcgcgctggaattcatgggcttttcggggcccgacgtgcaggagggccttcgttcg
ctgcgcgagcggcgcccgcccgcgtttcccggcgacgcgccgttctga

DBGET integrated database retrieval system