KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02975Help
Entry
BMULJ_02975       CDS       T00740                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bmj00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3218057..3219055
Genome map
AA seq 332 aa AA seqDB search
MSFHPLHRPRRMRRDDFSRRLMRENRLTTDDLIYPVFVVEGTNERQPVPSMPGVERVSVD
LLMQVAEQCVELGVPVLSLFPAIEPALKTPDGREAGNPEGLIPRAVRELKKRFPELGVLT
DVALDPYTSHGQDGVLDENGYVINDDTIEILIEQARAQAEAGVDIVAPSDMMDGRIGAIR
EMLESDGHIHTRIMAYSAKFASAFYGPFRDAVGSASNLGKGNKMTYQMDPANSDEALREV
RLDIDEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSGEYAMLKAAAMNGWLDHDKV
VLESLLAFKRAGADGVLTYFALDAARLLKAQR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccatccgcttcatcgtccgcgccggatgcgccgcgacgatttctcccggcgc
ctgatgcgcgaaaaccgcctgaccaccgacgatctgatctaccccgtgttcgtcgtcgaa
ggcacgaacgagcggcagcccgtgccgtcgatgcccggcgtcgagcgcgtatcggtcgat
ctgctgatgcaggtggccgagcagtgcgtcgaactgggcgtgccggtgctgtcgctgttc
cccgcgatcgagccggcgctgaagacgccggacggccgcgaggcgggcaaccccgaaggc
ttgattccgcgcgcggtgcgtgaactcaagaagcgcttccccgaactcggcgtgctgacc
gacgtcgcgctcgatccgtacacgagccacggccaggacggcgtgctcgacgagaacggc
tatgtgatcaacgacgatacgatcgagatcctgatcgagcaggcgcgcgcgcaggccgaa
gccggcgtcgacatcgtcgcgccgtcggacatgatggatgggcgcatcggcgcgattcgc
gagatgctcgaaagcgacgggcatatccatacgcgcatcatggcgtactcggccaagttc
gcgtccgcgttctacggcccgttccgcgatgcggtcggctcggcgtccaatctcggcaag
ggcaacaagatgacctaccagatggatcccgcgaacagcgacgaagcgctgcgcgaagtg
cgcctcgacatcgacgaaggcgcggacatggtgatggtcaagcccggcatgccgtatctc
gacatcgtgcgccgcgtgaaggacgaattccgctttccgacctacgtctatcaggtgagc
ggcgaatacgcgatgctgaaggccgccgcgatgaacggctggctcgaccacgacaaggtc
gtgctcgaatcgctgctcgcgttcaagcgcgcgggcgccgacggcgtgctcacatacttc
gcgctcgatgccgcgcgtctgctgaaagcgcaacgctga

DBGET integrated database retrieval system