KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03209Help
Entry
BMULJ_03209       CDS       T00740                                 

Gene name
bdh
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bmj00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bmj00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(13665..14450)
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNLDGANAVADEINKAGGKAIGV
AMDVTNEEAVNTGIDKVAETFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGNTVDGVFTTVQDVAQTVLFLS
AFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctgaatggcaagaccgcagtcgtcacgggcgccgcgagcggcatcggcaag
gaaatcgcgctggagctggcgaaggcgggtgcggccgtcgcgatcgccgatctgaacctg
gacggcgcgaacgcggtcgccgacgagatcaacaaggccggcggcaaggcgatcggcgtc
gcgatggacgtgaccaacgaggaagccgtcaacaccggcatcgacaaggtcgccgagacg
ttcggctcggtcgacattctcgtgtcgaatgccggcatccagatcgtcaacccgatcgag
aactactcgttcgccgactggaagaagatgcaggcgatccacgtcgacggcgcgttcctc
acgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggtgtcgtgatctac
atgggctcggtgcactcgcacgaggcgtcgccgctgaagtcggcctacgtgacggccaag
cacggcctgctcggtctcgcgcgcgtgcttgcgaaggaaggcgcgaaacacaacgtgcgc
tcgcatgtcgtgtgtccgggtttcgtgcgcacgccgctcgtcgacaagcagattccggag
caggccaaggagctcggcatcagcgaagaggaagtcgtgaagaaggtgatgctcggcaat
acggtcgacggcgtgttcacgaccgtgcaggacgtcgcgcagacggtgctgttcctgtcg
gcgttcccgagcgccgcgctgaccggtcagtcgttcgtcgtcagccacggctggttcatg
caatga

DBGET integrated database retrieval system