KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03320Help
Entry
BMULJ_03320       CDS       T00740                                 

Gene name
speB
Definition
(GenBank) agmatinase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase 2-Hacid_dh UPF0489
Motif
Other DBs
NCBI-ProteinID: BAG45193
UniProt: A0A0H3KJ12
Position
2:complement(124383..125333)
Genome map
AA seq 316 aa AA seqDB search
MHRELNQPMGGNEMPRFGGIATMMRLPQADTTDGLDACFVGVPLDLGTSNRSGSRFGPRQ
IRAESVLLRPYNMATRAAPFDSLQVADIGDVATNPYDLKDSVRRIEEAYDRIVANGCRPI
TLGGDHTIAWPILRALHRKYGKVAVVHVDAHADVNDTMFGEKIAHGTPFRRAVEDGLLQC
DKVTQIGLRGTGYHADDFDWCREQGFTVVQAEACWNQSLAPLMAQVRERVGDTPVYLSFD
IDGLDPSFAPGTGTPEIGGLSVQQGLEIVRGMKGLNIVGADLVEVSPPYDPAGTTALVGA
NLAFEMLCVMPGVAYR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcgaactgaaccaaccgatgggcggcaacgagatgccgcgctttggcggcatc
gccacgatgatgcgcctgccgcaggccgacacgaccgacggcctcgacgcatgcttcgtc
ggcgtgccgctcgacctcggcacgtcgaaccgctcggggtcgcgcttcggcccgcgccag
atccgcgccgaatcggtgctgctgcgcccctacaacatggccacgcgcgccgcgccgttc
gattcgctgcaagtggccgacatcggcgacgtcgcgacgaacccgtacgacctgaaggat
tcggtgcgccgcatcgaggaggcgtacgaccggatcgtcgcgaacggctgccgcccgatc
acgctcggcggcgatcacacgatcgcctggccgatcctgcgcgcgctgcaccggaaatac
ggcaaggtcgccgtcgtgcatgtcgatgcgcacgcggacgtcaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgtttcgccgcgcggtcgaagacgggctgctgcaatgc
gacaaggtcacgcagatcgggctgcgcggcaccggctatcacgccgacgatttcgactgg
tgccgcgagcagggtttcaccgtcgtgcaggccgaggcatgctggaaccaatcgctggca
ccgctgatggcacaggtgcgcgagcgcgtcggcgacacgcccgtctatctgagcttcgac
atcgacggcctcgatccgtcgttcgcacccggcaccggcacgccggagatcggcgggctg
tccgtccagcagggcctcgaaatcgtgcgcgggatgaagggcttgaacatcgtcggcgcg
gatctcgtcgaagtgtcgccgccgtacgatccggccggcaccacggcgctcgtcggcgcg
aacctcgcgttcgagatgctgtgcgtgatgccaggcgtcgcgtaccgctga

DBGET integrated database retrieval system