KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03320Help
Entry
BMULJ_03320       CDS       T00740                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmj00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(124383..125333)
Genome map
AA seq 316 aa AA seqDB search
MHRELNQPMGGNEMPRFGGIATMMRLPQADTTDGLDACFVGVPLDLGTSNRSGSRFGPRQ
IRAESVLLRPYNMATRAAPFDSLQVADIGDVATNPYDLKDSVRRIEEAYDRIVANGCRPI
TLGGDHTIAWPILRALHRKYGKVAVVHVDAHADVNDTMFGEKIAHGTPFRRAVEDGLLQC
DKVTQIGLRGTGYHADDFDWCREQGFTVVQAEACWNQSLAPLMAQVRERVGDTPVYLSFD
IDGLDPSFAPGTGTPEIGGLSVQQGLEIVRGMKGLNIVGADLVEVSPPYDPAGTTALVGA
NLAFEMLCVMPGVAYR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcgaactgaaccaaccgatgggcggcaacgagatgccgcgctttggcggcatc
gccacgatgatgcgcctgccgcaggccgacacgaccgacggcctcgacgcatgcttcgtc
ggcgtgccgctcgacctcggcacgtcgaaccgctcggggtcgcgcttcggcccgcgccag
atccgcgccgaatcggtgctgctgcgcccctacaacatggccacgcgcgccgcgccgttc
gattcgctgcaagtggccgacatcggcgacgtcgcgacgaacccgtacgacctgaaggat
tcggtgcgccgcatcgaggaggcgtacgaccggatcgtcgcgaacggctgccgcccgatc
acgctcggcggcgatcacacgatcgcctggccgatcctgcgcgcgctgcaccggaaatac
ggcaaggtcgccgtcgtgcatgtcgatgcgcacgcggacgtcaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgtttcgccgcgcggtcgaagacgggctgctgcaatgc
gacaaggtcacgcagatcgggctgcgcggcaccggctatcacgccgacgatttcgactgg
tgccgcgagcagggtttcaccgtcgtgcaggccgaggcatgctggaaccaatcgctggca
ccgctgatggcacaggtgcgcgagcgcgtcggcgacacgcccgtctatctgagcttcgac
atcgacggcctcgatccgtcgttcgcacccggcaccggcacgccggagatcggcgggctg
tccgtccagcagggcctcgaaatcgtgcgcgggatgaagggcttgaacatcgtcggcgcg
gatctcgtcgaagtgtcgccgccgtacgatccggccggcaccacggcgctcgtcggcgcg
aacctcgcgttcgagatgctgtgcgtgatgccaggcgtcgcgtaccgctga

DBGET integrated database retrieval system