KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03573Help
Entry
BMULJ_03573       CDS       T00740                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMULJ_03573 (cheB)
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BMULJ_03573 (cheB)
Two-component system [BR:bmj02022]
 CheA family
  WspE-WspRF [MD:M00509]
   BMULJ_03573 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:407435..408460
Genome map
AA seq 341 aa AA seqDB search
MNIGIVNDLPLAVEALRRVLAQRPDHRVLWVASDGDEAVDFCVAHPPDLVLMDLVMPRLD
GVAATRAIMARAPCAILIVTASVSANTSSVYEAMGAGALDAVDTPTLALGLSADAPPQPL
LAKIDQIGRLLDSRAPAFVPLRPPVGAQRQPTLVAIGASAGGPTALATLLRTLPADFPAA
IVIVQHVDQAFALGMAEWLDGHTRLPVRVARHGCTPRAGEVLLAATNDHLCLSSRGVLGY
TREPADTPYRPSIDVFFDSVAECWRGDALGVLLTGMGRDGALGLKAMRAKGCYTIAQDEA
TSAVYGMPKAAAAIGAASAILPLDRIAPQLIARVARRAARP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgatctgccgctcgcggtcgaggcactgcgccgcgtgctc
gcgcagcggcccgatcatcgcgtgctgtgggtcgcgtcggacggcgacgaggccgtcgat
ttctgcgtcgcgcatccgcccgatctcgtgctgatggatctcgtgatgccgcggctcgac
ggcgtcgcggcgacgcgcgcgatcatggcgcgcgcgccgtgcgcgatcctgatcgtcacc
gcgagcgtcagcgcgaatacctcgtcggtctacgaggcgatgggcgcgggtgcgctcgac
gcggtcgacacgccgacgctcgcgctcgggctctcggccgatgcgccgccgcagccgctg
ctcgcgaagatcgaccagatcggccggctgctcgacagccgcgccccggcgttcgtgccg
ctgcggccgccggtgggcgcgcagcgtcagccgacgctcgtcgcgatcggcgcgtcggcg
ggtgggccgaccgcgctcgccacgctgctgcggacgctgccggccgatttcccggccgcg
atcgtgatcgtccagcacgtcgaccaggcgttcgcgctcggcatggccgaatggctcgac
ggccacacgcggctgccggtgcgcgtcgcgcggcacggctgcacgccgcgcgccggcgag
gtgctgctcgcggcgaccaacgatcatctgtgtctgtcgtcgcgcggcgtgctcggctac
acgcgcgaaccggccgacacgccgtatcggccgtcgatcgacgtgttcttcgacagcgtc
gccgagtgctggcgcggcgacgcgctcggcgtgctgctgaccggcatgggccgcgacggc
gcgctcgggctcaaggcgatgcgcgcgaagggctgctatacgatcgcgcaggacgaagcg
acgagcgccgtgtacgggatgccgaaggcggccgccgcgatcggcgcggcatcggcgatc
ctgccgctcgaccggattgcgccgcagctgatcgcgcgcgtcgcgcgccgcgccgcgcgt
ccgtga

DBGET integrated database retrieval system