KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03733Help
Entry
BMULJ_03733       CDS       T00740                                 

Gene name
ssuB
Definition
(GenBank) sulfonate/nitrate/taurine transport system ATP-binding protein
  KO
K15558  
phthalate transport system ATP-binding protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
ABC transporters
Module
Phthalate transport system
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BMULJ_03733 (ssuB)
Transporters [BR:bmj02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Phthalate transporter [MD:M00437] [OT]
    BMULJ_03733 (ssuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(566563..567345)
Genome map
AA seq 260 aa AA seqDB search
MSNIIINGLTKSFDTPTGPITVLDNIDLTVQEGEFVCLLGPSGAGKSVTLNCISGFLPPT
SGSVMVDGTPVTTARPRYGYVFQQPRLLQWRTVEENLIFALRAESGRPVKDEARRVRDVL
DLVNLTGYEHFYPHQISGGMQHRVGIARAYIRDSGLLLMDEPFGALDEITARKLRAELVS
TWMKNRRTVVFVTHDIIEACYLADRIVVYTPKPTRIASVINVDLPRPREYGSQQMHALES
EVLGVFEQSMKEFMETAGST
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatcatcattaacggtctcacgaagtcattcgatacgcccaccgggcccatc
accgttctggacaacatcgacctcacagtccaggaaggcgaattcgtttgcctccttggt
ccgtcgggcgcaggcaagtccgtcacgttgaactgtatttccggattcctcccccccact
tcggggagtgtcatggtggacggcacgccggttacaactgcaaggccgcgttatgggtat
gtgttccagcaaccaaggttgctccagtggcgcaccgtcgaagagaatcttatattcgcc
ctgcgcgccgaaagcggccgtccggtaaaggatgaagcacggagggttcgggacgtcctt
gatctggtgaacctgaccggttatgagcacttctacccgcatcagatctccggcggcatg
cagcatcgcgtcggtatcgcccgcgcctatatccgcgactccgggctcctgctcatggac
gaaccgtttggggcactcgacgaaatcaccgcccgcaaactgcgggctgaactggtcagc
acgtggatgaagaaccggcgcactgttgtcttcgtcactcacgacatcatcgaagcgtgc
tatctcgccgaccggatcgtcgtctacacgcccaagccgaccaggatcgcctccgtcatc
aatgttgatctgcctcggccgcgggaatacggaagccagcagatgcacgcgctcgaatca
gaggtactcggtgtgtttgagcaaagcatgaaggaattcatggagacggccggcagtacc
tga

DBGET integrated database retrieval system