KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03820Help
Entry
BMULJ_03820       CDS       T00740                                 

Definition
signal transduction histidine kinase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMULJ_03820
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BMULJ_03820
Enzymes [BR:bmj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     BMULJ_03820
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BMULJ_03820
Two-component system [BR:bmj02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BMULJ_03820
Bacterial motility proteins [BR:bmj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BMULJ_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(664802..668458)
Genome map
AA seq 1218 aa AA seqDB search
MGSILSEQLKLVVLGGSAGSLDPLRAIVAALPSDPGFAVLVITHLDPKEESRLPDILQAD
ARMPVEKLVHLRKIEHDRIYVLPENAGVIALDGHFRLTRRQAGLNLPIDGCLASLAQDPD
VNGAAVILSGTGRDGAGGLVDLKASGGFVIAQQPQTAIHHGMPTAAIDTGLVDEVLSLED
IAPCLVRRFGDPARSAEAADAQTADDDALGTAISIVQQKTGINLAYVKDVNLRRRFLRRV
LLQKDRDVDAYLQLLRSDAREAEALRDDILIGVTAFFRDAEFVNVLRQSVIPALLELKHD
PIRVWVPACSTGEEVYTIATLLKEALDRDALHRRVQIFGTDINEASIEIARAGRYSLASV
DDVPEAFRERTFAATSGGYVVRKAIREMCVFARHNVLTHAPFSGMDLISCRNLLIYLRKE
AQQHVLEVLHYACRPDGFLLLGRAEAVSGADGFEHAGAPHLYRKVPAAKRQQGAFPIDAL
RPWASQGTAPPARRAQQADPVLEAANRTALERYAPPGFVVDDKGDVVHFRGDVSGFVAPA
SGEASLALPRLLQPELNVTVRTALIEAKRTGQPVRRERVALGDTHFALEVLPLAAEDLVP
HYLVTLERLPDDAPAPQNTNTGSPHSRVQELERTVTTLSDELEATQAQLKSVVAEFESAN
EELRTANEEMLSTNEELQSANEELLLAKQELESANQELASLNDELKSRNEQLDRVNDDLS
NLVEGIPLPVVVLDRQLRLRHFSPQAQALFGLPDDSVGQPLAQLNSLFSAVDLERVVQSA
VQGLADVEHEYQDSEGRWWLVNVRAYRTADDRIDGAVLAFQDIHQLKSALGTAQSAQLDA
ERANTAKDNFLALVSHELRAPLNVISSWAAVLMTASERGMPTDEQMSQRAVTTILRHCQL
QAELIDDLLDVSRISSGRFSLDSKPVDFAAAVRTVVESHRPVAAKKEIMLATSGLQSQAV
VSGDARRLQQVASNLIGNALKFTPQGGRVEVALTRLGALIELSVADNGIGVKPELLPRLF
DRFMQSDTSRTRQYGGLGLGLSIVKHLVTAHGGTVTASSEGEGRGTRLTVRIPLLQTAAT
EPGTVATAPAESARLDGLSVLLVDDDVPAQEPLAHLLRGLGAQVQIASGAKEALACLAAG
SFDILVSDLAMPGADGHALLRDVRSREGGRRRIYALALTGLASIHDRDAAIAAGFDDHLP
KPVDVKVLLEKLSLGRGR
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
gtggggtcgattttgtcggagcagttgaagctcgtcgtgctgggaggatcggctggcagc
ctcgacccgttgcgcgcgatcgtcgccgcgctgccgagcgatcccggcttcgccgtgctc
gtcatcacgcacctggatccgaaggaggaaagccggctgcccgacatcctgcaagcggat
gcgcgcatgccggtcgaaaaactcgtccatctgcgcaagatcgaacacgaccgcatctat
gtgctgcctgaaaacgcgggcgtgattgcactggacggccatttccgattgacgcgcaga
caggccggcctcaacttgccgatcgacgggtgcctggcgtcgctcgcgcaggatccggac
gtcaacggcgcggcagtgatcctgtcgggcaccggccgggacggtgcaggcgggctggtg
gacctgaaggcttccggcggcttcgtcatcgcacagcagccgcagacggctattcatcat
ggtatgccgaccgcggcgatcgacacgggtctggtcgacgaagtgctgtcgctcgaggac
atcgccccgtgcctggtgcggcgcttcggcgatcctgcccgcagcgccgaagcagccgat
gcgcagacggccgacgacgacgcgctcggcacggccatctcgattgttcagcagaaaacc
ggcatcaacctcgcctacgtcaaggatgtcaatctacgccgccgattcctgcgccgcgtg
ctgctgcagaaggatcgggacgtggatgcgtacctgcagctgctgcgcagcgatgcgcgc
gaagccgaggcgctgcgcgacgacatcctgatcggcgtgacggccttctttcgcgacgcc
gagttcgtcaacgtgctgcgccaatcggtcattccggcgctgctggaactgaagcacgac
ccgatccgcgtctgggtgcccgcctgctcgacaggcgaggaggtctacaccatcgcgacg
ctgctgaaggaggcactcgatcgcgacgcgctgcatcgccgcgtgcagatcttcggcacc
gacatcaacgaggcatcgatcgaaattgcgcgggccggccgctacagcctggcgtcggtc
gacgacgtgccggaggcgtttcgcgaaagaacgttcgccgccacgtcgggcggctatgtg
gtgcgcaaggcgattcgcgaaatgtgcgtgttcgcgcggcacaacgtgctgacccacgcg
cccttctcgggcatggacctcatcagctgccgcaacctgctgatctacctgcgcaaggag
gcacaacagcacgtgctcgaggtgttgcactacgcatgccggcccgacggatttctgctg
ctcggccgcgccgaggccgtatcgggcgccgacggattcgagcacgccggcgcgccgcac
ctgtaccgcaaggtgccggcggccaagcggcagcaaggcgcgttcccgatcgacgcactg
cgtccatgggcgagccagggcaccgcgccgccggcacgccgcgcgcaacaggccgatccc
gttctggaggcggccaatcgcacggcgctcgagcgctatgcaccgccgggtttcgtcgtc
gacgacaagggcgacgtcgtgcactttcgcggcgacgtgtcgggcttcgttgcgccggcg
agcggcgaggcgtcgctggctctgccgcgcctgctgcagcccgagctcaatgtcacggtg
cgcaccgcgctgatcgaggccaagcggacaggccaacccgtgcggcgcgagcgcgtcgcg
ctcggcgacacgcatttcgcgctggaagtcctgccgctcgccgccgaggacctggtgccg
cactatctggtcacgctcgaacgattgcccgacgacgcgcccgcgccgcagaacacgaat
acgggctcgccgcacagccgcgttcaggaactcgaacgcacggtcacgacgctgtccgac
gaactcgaggccacgcaagcgcagctcaagtccgtcgtcgccgaattcgaatcggccaac
gaggaactgcgcacggccaacgaggagatgctcagcaccaacgaagagctgcaaagcgcg
aacgaggaactgctgctggccaagcaggaactggaatcggccaaccaggagcttgcgtcg
ctgaacgacgagctgaaatcgcgcaacgagcaactcgaccgcgtcaacgacgacttgagc
aatctggtcgaaggcatcccgctaccggtcgtcgtgctggaccggcagctgcgcctgcgg
catttttcgccgcaggcgcaagcgctgttcgggttgccggacgacagtgtcggacaaccg
ctcgcgcagttgaacagcctgttctcggcggtcgacctcgaacgcgtcgtgcagtcggcc
gtgcagggattggcggatgtcgagcacgagtatcaggacagcgaaggccgatggtggctc
gtcaacgtgcgtgcctatcgcacggccgacgaccgcatcgacggcgccgtactcgccttc
caggacatccatcagctcaaaagcgccctcggtaccgcacagtccgcgcaactcgatgcg
gaacgcgccaataccgcgaaggacaacttcctcgcgctcgtatcgcacgaactgcgcgcg
ccgctgaacgtgatctcgagctgggcggccgtgctcatgacggcaagcgagcgcggcatg
ccgaccgacgagcaaatgagtcagcgcgcggtcacgaccattctgcggcattgtcagctg
caggccgaactgatcgacgatttgctggacgtctcgcgcatctcgtcgggacggttctcg
ctcgattcgaagccggtcgactttgctgcggccgtacgcaccgtggtggagagccatcgc
ccggtggcggccaagaaggagatcatgctcgcgacgtcgggattgcaaagccaggcggtc
gtcagcggcgacgcgcgccgtctgcagcaggtcgcatcgaatctgatcggcaatgcgttg
aagttcacgccgcagggcggccgtgtcgaagtcgcattgacgcgtctcggtgcgctgatc
gagctctcggtcgccgacaacggcatcggcgtcaagccggaattgctgccgcggctgttc
gaccgtttcatgcagtccgacaccagtcgcacgcgccagtatggcggcctcggcctgggc
ctgtcgatcgtcaagcatctggtgacggcgcacggcggcacggtgaccgccagcagcgag
ggtgaaggtcgcggcaccaggctgacggttcgcataccgttgctgcagacggccgcgacg
gaaccgggaaccgtcgccaccgcgccggcggaatcggcacggctcgacggcctgtcggtg
ctgctcgtcgacgacgacgtgccggcccaggagccgttggcgcacttgctgcgcgggctc
ggcgcgcaagtgcagatcgcttccggtgcgaaagaagcgctcgcctgtctcgctgccggc
tctttcgatattctcgtcagcgatctcgccatgcccggcgccgacggccatgcgctgctg
cgcgacgtgcgcagtcgcgaaggcggccgacggcgcatctacgcgctggccctgacgggc
ctcgcgtcgatacacgatcgggacgccgcgattgccgccggcttcgacgaccatttgccg
aagccggtggatgtgaaggtgctgctggaaaagctgtctctggggcggggcagatag

DBGET integrated database retrieval system