KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03865Help
Entry
BMULJ_03865       CDS       T00740                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMULJ_03865 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMULJ_03865 (sdhD)
   00650 Butanoate metabolism
    BMULJ_03865 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BMULJ_03865 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:722093..722461
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFS
AQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacaaccgaatcggctcgaagcgcctcgtcgtcggcgcgcactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgttcttcggcgcgcacgacttctcctacgaaggctgggcgtcgatcttctcc
gcacaatggatgaagctcgcgaccttcgtgacgctgctttccctcttctatcacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system