KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03880Help
Entry
BMULJ_03880       CDS       T00740                                 

Gene name
ccpA
Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:736881..738182
Genome map
AA seq 433 aa AA seqDB search
MRAARMGWAAAGRSGWRTLGVALALAIGFGAMRVAPGAAAPSPDADGAADAREMAALGKL
MFFDPSLSASGRMSCATCHSPAHAYGPPNGLAAQFGGADLKRQGTRAVPSLRYVLNRTPA
WSHAQAASMAERLTETDNAPIGGFGWDGRFNRLRDQASFPLLNPDEMANPSAEAVVAKLR
RAPYADRFRRVFGAHAFDDLTQAFANATRAIERFELDDPSFHPYTSKFDYYLDGKVALSA
QELRGKRLFDDPARGNCASCHIDQPGVNGAHPLLTDFTFEALGVPRNRELRANANPGYYD
LGLCGPLRTDQTADRTNCGLFKTPSLRNAASRRVFFHNGRFHTLKDALRFYVQRDTDPAK
WYPADRRGRVVQYDDLPPQLRVNVDRTDEPLTRKRGERPVWSERDIDDVAAFLATLDDGY
VLPVHTASRRVSP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgagggcggcgcgcatggggtgggcggcagcggggcgcagcgggtggcgaacgctgggc
gtcgcgctcgcgcttgcaatcgggttcggcgcgatgcgcgttgcgccgggcgcggcggcg
ccgtcgcccgacgcagacggcgcagccgacgcacgcgaaatggccgcgctcggcaagctg
atgttcttcgatccgtcgctgtcggcgtcgggccggatgtcgtgcgcgacctgtcacagc
cctgcgcacgcgtacgggccgccgaacggtctcgccgcccagttcggcggcgcggacctg
aagcggcaaggcacgcgcgcggtgccgagcctgcgttacgtgctgaaccgtacgccggcc
tggtcgcatgcgcaggcggccagcatggccgagcggctgacggaaaccgacaacgcgccg
atcggcggcttcggctgggacggccgcttcaaccggctgcgcgaccaggcgagctttccg
ctgctgaatccggacgagatggcgaacccgagtgcggaagccgtcgtcgcgaagctgcgg
cgcgcgccgtacgcggatcgctttcgccgcgtattcggcgcgcacgcgttcgacgatctg
acccaggcgtttgcgaacgcgacgcgcgcgatcgagcgtttcgagctcgacgatccgagc
ttccatccgtacacgagcaagttcgactactaccttgacggcaaggtcgcactgagcgcg
caggaactgcgcggcaagcggctgttcgacgatcccgcgcgcggcaactgcgcgtcgtgt
cacatcgatcagccgggcgtgaacggcgcgcatccgctgctgaccgatttcacgttcgaa
gcgctcggtgtgccgcgcaaccgcgaattgcgagcgaatgcgaatcccggttactacgat
ctcgggctatgcggcccgttgcggacggaccagacggccgaccgtacgaactgcgggcta
ttcaagacgccgtcgctgcgcaacgcggcgtcgcgccgcgtgtttttccacaacggccgc
tttcacacgctgaaggacgcgctgcgcttctacgtgcagcgcgataccgatccggcgaag
tggtatccggccgaccggcgcggccgcgtcgtgcagtacgacgatctgccgccgcagttg
cgcgtgaacgtcgaccggaccgacgagccgctcacgcgcaagcgcggcgagcgcccggtc
tggagcgagcgcgatatcgacgacgtcgcggcgttccttgcgacgctcgacgacggatac
gtgttgccggtgcatacggcgagccggcgggtgtcgccgtga

DBGET integrated database retrieval system