KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03889Help
Entry
BMULJ_03889       CDS       T00740                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmj01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bmj00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bmj00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:747554..748747
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRGAYAKYQNDPDFVAEFQRELKHFVGRPSP
IYHAQRWSDTLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIENTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDASVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGITL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgacgatcgcggccacttcggcccgtatggcggcgtgttcgtcgcc
gagacgctgattcacgcgctggacgagctgcgcggcgcgtacgcgaaataccagaacgac
cccgatttcgtcgccgaattccagcgcgaactgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgacacgctcggcggcgcgcagatctatctgaagcgc
gaagatttgaaccacacgggcgcgcacaagatcaacaacgtgatcggccaggcgctgctt
gcgaagcgcatgggcaagaagcgcgtaatcgccgagacgggcgccggccagcacggcgtc
gccaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggcgccgag
gacgtgcgccgccaggccgccaacgtgtaccggatgaagctgctcggcgcgaccgtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaggcgatgcgcgactgg
gtcacgaacatcgagaacacgttctacatcatcggcacggtcgcgggcccgcatccgtac
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaaggtgcagatgccc
gaactcgccgggcgccagcccgacgcggtgatcgcctgcgtcggcggcggctcgaacgcg
atggggatcttctatccgtacatcgacgacgcgtcggtgcagctgatcggcgtcgaagcc
gcgggcgacggcctcgacaccggccatcacgcagcctcgctgatcgccggcagcccgggc
gtgctgcacggcaaccgcacctatctgctgcaggacgacaacggccagatcatcgagacg
cattcggtgtcggccggcctcgactatccgggcgtcggtcccgagcacgcatggctgaag
gacagcggtcgcgcgcagtacgtcgggatcaccgacgaagaggcgctgaaggcgttccac
gactgctgccggatcgagggcatcatccccgcgctcgagtcgagccacgcgatcgcgtat
ggcgtgaagctcgcgccgacgttgccgaaggacaagatcctgctcgtcaatctgtcgggc
cgcggcgacaaggacatgcatacggtcgccgagcgatcgggcatcacgctctga

DBGET integrated database retrieval system