KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03891Help
Entry
BMULJ_03891       CDS       T00740                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:749697..750512
Genome map
AA seq 271 aa AA seqDB search
MSRIQQTFAALAQQGRKGLIPFITAGDPDPAKTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQRSSERALARGVTLKHVLADVKRFRETNQTTPVVLMGYANPIERHGVDAFAADARA
AGVDGVLVVDYPPEEAAVFAEKMRAAGIDPIFLLAPTSTDARIAEVGKIASGYVYYVSLK
GVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQLL
ESAAPEGAVAALQAFIAELRAALDGAANTAR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtattcagcagaccttcgccgcactcgcccagcagggccgaaagggcctgatc
ccgttcatcacggccggcgacccggatcccgcgaaaacggtcgaattcatgcacgcgctc
gccgccggcggcgcggacgtcatcgagctcggcgtgccgttctcggacccgatggccgac
ggccccgtgatccagcgctcgtcggaacgcgcgctcgcgcgcggcgtcacgctcaagcac
gtgctcgccgacgtcaagcgctttcgcgagaccaatcagacgacgcccgtcgtgctgatg
ggctatgcgaaccccatcgagcggcacggcgtcgacgcgttcgcggccgatgcgcgcgcg
gcgggcgtcgacggcgtgctcgtcgtcgactatccgcccgaagaagcggccgtattcgcc
gagaaaatgcgtgcagccggcatcgacccgatcttcttgctcgcgccgacgtcgaccgac
gcgcgcatcgcggaagtgggcaagatcgcgagcggctacgtgtactacgtgtcgctgaag
ggcgtgaccggcgccggaaatctggatgtttcgagcattgcgggtaaaatcccggccatc
aagtcgcgcgtgccggttccggtgggcgtcggcttcggcatccgcgacgccgaaacggca
cgtgcggtggccgaggtgtcggacgccgtcgtgatcggcagccgcctcgttcagctgctc
gaaagcgctgcgccggaaggcgccgtcgccgcgctgcaggccttcattgccgagctgcgc
gccgcgctggacggcgcggcgaacacggcgcgataa

DBGET integrated database retrieval system