KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03906Help
Entry
BMULJ_03906       CDS       T00740                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMULJ_03906 (galU)
   00052 Galactose metabolism
    BMULJ_03906 (galU)
   00500 Starch and sucrose metabolism
    BMULJ_03906 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BMULJ_03906 (galU)
Enzymes [BR:bmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMULJ_03906 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:769093..769980
Genome map
AA seq 295 aa AA seqDB search
MLKVNKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIAREDSRSYGVIEGREWE
EDVIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRRLKPGAGGELQLTDAVQSLLA
NEQVLAYRYYGTRFDCGSKLGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaacaaggccgtgtttcccgtcgccggtctcggcacgcggttccttccg
gcaacgaaggcgagcccgaaagagatgctgcccgtcgtcgacaagccgctgatccagtat
gcggtcgaggaggcgatcaacgccggcattaccgagatgatcttcgtgacgggccgcagc
aagcgcgcgatcgaggatcatttcgacaagtcgtacgagatcgaagccgagctcgaggcg
cgcggcaaggaaaagctgctggagctcgtgcgcagcatcaagccgagccatgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctcgggcatgccgtgctgtgcgccgagaag
ctcgtgcacggcgagccgttcgcggtgattctcgcagacgatctgctgcacggcgagcag
cccgtgctcaagcagctcgtcgacgtgttcgatcactatcacagctcggtaatcggcgta
gagacgatcgcacgcgaggacagccgctcgtacggcgtgatcgaaggccgcgagtgggaa
gaggacgtgatcaagctgtccggcatcatcgagaagccggcacccgaagacgcgccgtcg
aacctcggcgtggtcggccgctacgtgttcatgccgacgatcttcgatcatctgcggcgg
ctgaagccgggcgcgggcggcgaactgcagctcaccgacgccgtccagtcgctgctcgcg
aacgagcaggtgctcgcgtatcgctactacggcacgcgtttcgactgcggcagcaagctc
ggctatctgaaggcgaccgtcgagctcgcgcttcagcatccggaggtcagccgcgaattc
gaagcgtatctgcgtacctgtctgcccgcgctggctgccgtcgcataa

DBGET integrated database retrieval system