KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03932Help
Entry
BMULJ_03932       CDS       T00740                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMULJ_03932 (glpK)
Enzymes [BR:bmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BMULJ_03932 (glpK)
Exosome [BR:bmj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMULJ_03932 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:801672..803213
Genome map
AA seq 513 aa AA seqDB search
MTESRTAILAIDEGTSGTRAALVDASGHVSCLAYLPLSVDSPRPGVVEQDANAILDKTLE
VCRATLAQAREQRMHIVALALATQRATAVLWDTETGRALVPAMVWQDTRHADELDRLAAD
WDRELLPYVGRPAGVRSPYLWAAHQLRTSQPVADAHRAGRLAFGTIDTWLLWHLSDARVC
VTTPTNATSASAYLLGEHRYFDRWIDALGFPRELLPALREDADAFGRTRADLLGIDVPIL
ACAGDQFAGAIGLGCVERGHAMCVHGTGSFVDLLTGTTRPNVGGRAEPGDAHDGTLAMTA
RRHGGVSHYSLETFVATTGSALRWLCEKLHWFDDPAQISTLAGSVDSSRGVTFVPALTGL
RVPRMEPNARALLSGISIATTQAEVAYAVLEGIAHSVTSCMEANQAVARADVSELIVGGG
LAGSDTLLQIQADVSGVPVRRIREGDRASLRGAAFLAGASGLLWDSLDAACATLVTDAVF
EPSIDAENRQRRRAAWHARIASELAHAADFAHA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcccgaaccgccattctcgcgatcgacgaaggcacgtccggcacgcgtgcc
gcgctcgtcgacgcgagcggacacgtgtcgtgcctcgcctacctgccgctgtcggtcgac
agcccgcgacccggcgtcgtggagcaggacgcgaacgcgatcctcgacaagacgctcgag
gtctgccgcgcgacgctcgcgcaagcgcgcgagcagcgcatgcacatcgtcgcgctcgcg
ctggcgacgcaacgcgcgaccgccgtgctgtgggataccgagaccggacgcgcgctggtg
ccggcgatggtctggcaggacacgcgccacgcggacgaactcgaccggctcgctgccgat
tgggaccgcgaactgctgccgtacgtcgggcggccggccggtgtgcgctcgccgtatctg
tgggctgcgcaccagctgcgcacgtcgcagccggtggccgatgcgcatcgcgcgggccgg
ctcgcgttcggcacgatcgatacctggctgctgtggcatctgtccgatgcgcgcgtgtgc
gtgacgacgccgaccaatgcgacgtccgcgagcgcttacctgcttggcgagcatcgctat
ttcgatcgctggatcgatgcgctgggtttcccgcgcgagttgctgccggcgctgcgcgag
gacgccgacgctttcggccgcacgcgcgccgacctgctcggcatcgacgtgccgatcctc
gcatgcgcgggcgaccagttcgcgggcgcgatcggcctcggctgcgtcgagcgcggccac
gcgatgtgcgtgcatggcacgggcagcttcgtcgatctgctgacgggcacgacgcggccc
aatgtcggcggccgggcggagcccggcgacgcgcacgacggcacgctcgcgatgaccgcg
cgccggcacggcggcgtgtcgcattactcgctcgagaccttcgtcgcaaccaccggctcc
gcgttgcgctggctctgcgagaagctgcattggttcgacgatccggcgcagatcagcacg
ctcgcgggcagcgtggattcgtcgcgcggcgtgaccttcgtgccggcattgacgggcttg
cgcgtgccgcgaatggagccgaatgcccgcgcgctgctgtcgggtatctcgatcgcgacg
acgcaggccgaagtcgcgtacgcggtactggaaggcatcgcacattcggtcacgtcgtgc
atggaagccaaccaggcggtcgcgcgggccgacgtgtccgagctgatcgtcggcggcggt
ctcgcgggcagcgacacgctgctgcagatccaggccgacgtcagcggtgtgccggtgcga
cggatccgcgagggcgatcgcgcgagcctgcgcggcgcggcgtttctcgcgggtgcctcc
gggttgctgtgggattcgctcgacgcggcctgcgcgacgctcgtcaccgatgccgtgttc
gagccgtcgattgatgcggagaaccggcagcggcggcgcgcggcatggcatgcgcggatt
gcgtccgagctggcgcacgcagccgattttgctcatgcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system