KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03932Help
Entry
BMULJ_03932       CDS       T00740                                 

Gene name
glpK
Definition
(GenBank) glycerol kinase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:801672..803213
Genome map
AA seq 513 aa AA seqDB search
MTESRTAILAIDEGTSGTRAALVDASGHVSCLAYLPLSVDSPRPGVVEQDANAILDKTLE
VCRATLAQAREQRMHIVALALATQRATAVLWDTETGRALVPAMVWQDTRHADELDRLAAD
WDRELLPYVGRPAGVRSPYLWAAHQLRTSQPVADAHRAGRLAFGTIDTWLLWHLSDARVC
VTTPTNATSASAYLLGEHRYFDRWIDALGFPRELLPALREDADAFGRTRADLLGIDVPIL
ACAGDQFAGAIGLGCVERGHAMCVHGTGSFVDLLTGTTRPNVGGRAEPGDAHDGTLAMTA
RRHGGVSHYSLETFVATTGSALRWLCEKLHWFDDPAQISTLAGSVDSSRGVTFVPALTGL
RVPRMEPNARALLSGISIATTQAEVAYAVLEGIAHSVTSCMEANQAVARADVSELIVGGG
LAGSDTLLQIQADVSGVPVRRIREGDRASLRGAAFLAGASGLLWDSLDAACATLVTDAVF
EPSIDAENRQRRRAAWHARIASELAHAADFAHA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcccgaaccgccattctcgcgatcgacgaaggcacgtccggcacgcgtgcc
gcgctcgtcgacgcgagcggacacgtgtcgtgcctcgcctacctgccgctgtcggtcgac
agcccgcgacccggcgtcgtggagcaggacgcgaacgcgatcctcgacaagacgctcgag
gtctgccgcgcgacgctcgcgcaagcgcgcgagcagcgcatgcacatcgtcgcgctcgcg
ctggcgacgcaacgcgcgaccgccgtgctgtgggataccgagaccggacgcgcgctggtg
ccggcgatggtctggcaggacacgcgccacgcggacgaactcgaccggctcgctgccgat
tgggaccgcgaactgctgccgtacgtcgggcggccggccggtgtgcgctcgccgtatctg
tgggctgcgcaccagctgcgcacgtcgcagccggtggccgatgcgcatcgcgcgggccgg
ctcgcgttcggcacgatcgatacctggctgctgtggcatctgtccgatgcgcgcgtgtgc
gtgacgacgccgaccaatgcgacgtccgcgagcgcttacctgcttggcgagcatcgctat
ttcgatcgctggatcgatgcgctgggtttcccgcgcgagttgctgccggcgctgcgcgag
gacgccgacgctttcggccgcacgcgcgccgacctgctcggcatcgacgtgccgatcctc
gcatgcgcgggcgaccagttcgcgggcgcgatcggcctcggctgcgtcgagcgcggccac
gcgatgtgcgtgcatggcacgggcagcttcgtcgatctgctgacgggcacgacgcggccc
aatgtcggcggccgggcggagcccggcgacgcgcacgacggcacgctcgcgatgaccgcg
cgccggcacggcggcgtgtcgcattactcgctcgagaccttcgtcgcaaccaccggctcc
gcgttgcgctggctctgcgagaagctgcattggttcgacgatccggcgcagatcagcacg
ctcgcgggcagcgtggattcgtcgcgcggcgtgaccttcgtgccggcattgacgggcttg
cgcgtgccgcgaatggagccgaatgcccgcgcgctgctgtcgggtatctcgatcgcgacg
acgcaggccgaagtcgcgtacgcggtactggaaggcatcgcacattcggtcacgtcgtgc
atggaagccaaccaggcggtcgcgcgggccgacgtgtccgagctgatcgtcggcggcggt
ctcgcgggcagcgacacgctgctgcagatccaggccgacgtcagcggtgtgccggtgcga
cggatccgcgagggcgatcgcgcgagcctgcgcggcgcggcgtttctcgcgggtgcctcc
gggttgctgtgggattcgctcgacgcggcctgcgcgacgctcgtcaccgatgccgtgttc
gagccgtcgattgatgcggagaaccggcagcggcggcgcgcggcatggcatgcgcggatt
gcgtccgagctggcgcacgcagccgattttgctcatgcgtaa

DBGET integrated database retrieval system