KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03937Help
Entry
BMULJ_03937       CDS       T00740                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BMULJ_03937 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_03937 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    BMULJ_03937 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMULJ_03937 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMULJ_03937 (adh)
   00626 Naphthalene degradation
    BMULJ_03937 (adh)
Enzymes [BR:bmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMULJ_03937 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:807424..808581
Genome map
AA seq 385 aa AA seqDB search
MNPFQFRTVPTLIVEYGAARRLGALLRARFPTLARLCVVTDAFLHRSGVLAPALDSLAAH
GWQVTVIDDVIADPPERVVLDATARAVAADAQIVLGLGGGSSMDVAKLIAVLAPGRQPLA
DMYGVDKVDTERLPLVQMPTTAGTGSEVTAVSIVTVGEARKMGVVSPHLFADVAILDAEL
TLGLPRAATAATGIDAMVHAIEAYTSARLKNPVSDMLAVQALTLLSRNLLAACDDGHDRH
AREAMLVGAMFAGQAFANAPVAAVHALAYPVGGIFHVPHGLSNALVLPHVLRFNAEAAAS
QYAELAAIVTPSATGSDEAKTHALIDEIDRLIVATGIPRTLREVGIGEGDLPRMAADAML
QTRLLVNNPREVTEADALEIYRRAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtttcaattccgcaccgtcccgacgctgatcgtcgaatacggcgccgcgcgc
cggctcggcgcgctgctgcgcgcgcgctttccgacgctcgcgcgcctgtgcgtggtgacc
gacgcgttcctgcaccgcagcggcgtgctcgcgcccgcgctcgacagcctcgccgcgcac
ggctggcaggtgaccgtgatcgacgacgtgatcgccgatccgcccgagcgcgtcgtgctc
gacgcgacggcgcgcgcggtcgcggccgatgcgcaaatcgtgctgggtctcggcggcggt
tcgtcgatggacgtcgcgaagctgatcgccgtgctcgcgccgggccggcagccgctcgcc
gacatgtacggcgtcgacaaggtcgacaccgagcggttgccgctcgtacagatgccgacg
acggcaggcaccggttcggaggtgacggccgtgtcgatcgtcacggtgggcgaggcgcgc
aagatgggcgtcgtgtcgccgcatctgttcgccgacgtcgcgattctcgacgccgagctg
acgctcgggctgccgcgcgcggcgacggccgcgaccggcatcgacgcgatggtgcatgcg
atcgaggcctacacgtccgcgcggctgaagaatccggtgtccgacatgctggccgtgcag
gcgctgacgctgctgtcgcgcaacctgctcgccgcatgcgacgacggccacgaccggcac
gcgcgggaagcgatgctggtcggcgcgatgttcgcaggtcaggcgttcgcgaacgcgccg
gtcgcggccgtgcatgcgctcgcgtatccggtcggcggtattttccacgtgccgcacggg
ctgtcgaacgcgctcgtgctgccgcatgtgctgcgcttcaacgcggaagcggccgcgtcg
cagtatgcggaactcgcggcgatcgtcacgccgtcggcgacgggtagcgacgaggcgaag
acgcacgcactgatcgacgagatcgaccggctgatcgtcgcgaccggcattccgcgtacg
ctgcgcgaggtcggcatcggcgaaggcgatctgccgcggatggccgcggacgcgatgctg
cagacgcgcctgctcgtcaacaatccgcgcgaagtgacggaggccgacgcgctcgagatc
tatcggcgcgcgtggtga

DBGET integrated database retrieval system