KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03937Help
Entry
BMULJ_03937       CDS       T00740                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bmj01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmj00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bmj00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bmj00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bmj00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:bmj00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:807424..808581
Genome map
AA seq 385 aa AA seqDB search
MNPFQFRTVPTLIVEYGAARRLGALLRARFPTLARLCVVTDAFLHRSGVLAPALDSLAAH
GWQVTVIDDVIADPPERVVLDATARAVAADAQIVLGLGGGSSMDVAKLIAVLAPGRQPLA
DMYGVDKVDTERLPLVQMPTTAGTGSEVTAVSIVTVGEARKMGVVSPHLFADVAILDAEL
TLGLPRAATAATGIDAMVHAIEAYTSARLKNPVSDMLAVQALTLLSRNLLAACDDGHDRH
AREAMLVGAMFAGQAFANAPVAAVHALAYPVGGIFHVPHGLSNALVLPHVLRFNAEAAAS
QYAELAAIVTPSATGSDEAKTHALIDEIDRLIVATGIPRTLREVGIGEGDLPRMAADAML
QTRLLVNNPREVTEADALEIYRRAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtttcaattccgcaccgtcccgacgctgatcgtcgaatacggcgccgcgcgc
cggctcggcgcgctgctgcgcgcgcgctttccgacgctcgcgcgcctgtgcgtggtgacc
gacgcgttcctgcaccgcagcggcgtgctcgcgcccgcgctcgacagcctcgccgcgcac
ggctggcaggtgaccgtgatcgacgacgtgatcgccgatccgcccgagcgcgtcgtgctc
gacgcgacggcgcgcgcggtcgcggccgatgcgcaaatcgtgctgggtctcggcggcggt
tcgtcgatggacgtcgcgaagctgatcgccgtgctcgcgccgggccggcagccgctcgcc
gacatgtacggcgtcgacaaggtcgacaccgagcggttgccgctcgtacagatgccgacg
acggcaggcaccggttcggaggtgacggccgtgtcgatcgtcacggtgggcgaggcgcgc
aagatgggcgtcgtgtcgccgcatctgttcgccgacgtcgcgattctcgacgccgagctg
acgctcgggctgccgcgcgcggcgacggccgcgaccggcatcgacgcgatggtgcatgcg
atcgaggcctacacgtccgcgcggctgaagaatccggtgtccgacatgctggccgtgcag
gcgctgacgctgctgtcgcgcaacctgctcgccgcatgcgacgacggccacgaccggcac
gcgcgggaagcgatgctggtcggcgcgatgttcgcaggtcaggcgttcgcgaacgcgccg
gtcgcggccgtgcatgcgctcgcgtatccggtcggcggtattttccacgtgccgcacggg
ctgtcgaacgcgctcgtgctgccgcatgtgctgcgcttcaacgcggaagcggccgcgtcg
cagtatgcggaactcgcggcgatcgtcacgccgtcggcgacgggtagcgacgaggcgaag
acgcacgcactgatcgacgagatcgaccggctgatcgtcgcgaccggcattccgcgtacg
ctgcgcgaggtcggcatcggcgaaggcgatctgccgcggatggccgcggacgcgatgctg
cagacgcgcctgctcgtcaacaatccgcgcgaagtgacggaggccgacgcgctcgagatc
tatcggcgcgcgtggtga

DBGET integrated database retrieval system