KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03976Help
Entry
BMULJ_03976       CDS       T00740                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmj02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bmj02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(851808..852812)
Genome map
AA seq 334 aa AA seqDB search
MNIGIVNDLPLAVEALRRVLARRPEHRVLWVATDGAQAVELCAAQPPDIVLMDLIMPKFD
GIEATRRIMRSARPCAILIVTSSIGANTWRVYEAMGAGALDAVDTPQLREGAAGDTADLL
LAKIDQIGRLLDAPGGVRAGCATHRAHGGPLVAIGASAGGPGALASILGSLPADFDAPIV
IVQHVDRAFAEGMAQWLDGQTPLAVRVAREGDRPQPGVALLAATDDHLRMTRAGTLAYTR
EPAATPYRPSVDVFFNSLTEHWSGNVIGVLLTGMGRDGAIGLKALRMKGYHTIAQDEATS
AVYGMPKAAATLGAARAILPLERIASELATLVRI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcggcatcgtcaacgacctgccgcttgccgtcgaggcactgcgccgcgtgctc
gcgcggcggcccgagcaccgcgtgctgtgggtcgcgaccgacggcgcgcaagccgtcgag
ctctgcgccgcgcagccgcccgacatcgtgctgatggatctgatcatgccgaagttcgac
gggatcgaggcgacgcggcgcatcatgcgttccgcgcgcccgtgcgcgatcctgatcgtc
acgagcagcatcggcgcgaacacctggcgcgtctacgaggcgatgggcgccggcgcgctc
gacgccgtcgatacgccgcagctgcgcgaaggcgcggccggcgacaccgccgatctgctg
ctcgcaaagatcgaccagatcggccgtctgctcgacgcgccgggcggcgtgcgcgccggc
tgcgcgacgcatcgcgcgcacggcggcccgctcgtcgcgatcggcgcgtcggccggcggc
ccgggcgcgctcgcgtcgattctcggcagcctgccggccgacttcgatgcgccgatcgtg
atcgtccagcacgtcgatcgcgcgttcgccgaaggcatggcgcaatggctcgacggtcag
acgccgctcgccgtgcgcgtcgcgcgcgaaggcgatcgcccgcagccgggcgtcgcgctg
ctcgccgcgacggacgatcatctgcggatgacgcgcgccggcacgctcgcgtatacgcgc
gaaccggccgcgacgccgtaccggccgtcggtcgacgtgttcttcaacagtctgaccgag
cactggtccggcaacgtgatcggcgtgctgctgacgggcatgggccgcgacggcgcgatc
gggctcaaggcgctgcggatgaagggctaccatacgatcgcgcaggacgaggcgacgagc
gccgtctacgggatgccgaaggcggccgcaacgctcggcgccgcgcgcgcgatcctgccg
ctcgagcgcatcgcgagcgaactcgcgacgctcgtgcgcatctga

DBGET integrated database retrieval system