KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03976Help
Entry
BMULJ_03976       CDS       T00740                                 

Definition
(GenBank) response regulator
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(851808..852812)
Genome map
AA seq 334 aa AA seqDB search
MNIGIVNDLPLAVEALRRVLARRPEHRVLWVATDGAQAVELCAAQPPDIVLMDLIMPKFD
GIEATRRIMRSARPCAILIVTSSIGANTWRVYEAMGAGALDAVDTPQLREGAAGDTADLL
LAKIDQIGRLLDAPGGVRAGCATHRAHGGPLVAIGASAGGPGALASILGSLPADFDAPIV
IVQHVDRAFAEGMAQWLDGQTPLAVRVAREGDRPQPGVALLAATDDHLRMTRAGTLAYTR
EPAATPYRPSVDVFFNSLTEHWSGNVIGVLLTGMGRDGAIGLKALRMKGYHTIAQDEATS
AVYGMPKAAATLGAARAILPLERIASELATLVRI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcggcatcgtcaacgacctgccgcttgccgtcgaggcactgcgccgcgtgctc
gcgcggcggcccgagcaccgcgtgctgtgggtcgcgaccgacggcgcgcaagccgtcgag
ctctgcgccgcgcagccgcccgacatcgtgctgatggatctgatcatgccgaagttcgac
gggatcgaggcgacgcggcgcatcatgcgttccgcgcgcccgtgcgcgatcctgatcgtc
acgagcagcatcggcgcgaacacctggcgcgtctacgaggcgatgggcgccggcgcgctc
gacgccgtcgatacgccgcagctgcgcgaaggcgcggccggcgacaccgccgatctgctg
ctcgcaaagatcgaccagatcggccgtctgctcgacgcgccgggcggcgtgcgcgccggc
tgcgcgacgcatcgcgcgcacggcggcccgctcgtcgcgatcggcgcgtcggccggcggc
ccgggcgcgctcgcgtcgattctcggcagcctgccggccgacttcgatgcgccgatcgtg
atcgtccagcacgtcgatcgcgcgttcgccgaaggcatggcgcaatggctcgacggtcag
acgccgctcgccgtgcgcgtcgcgcgcgaaggcgatcgcccgcagccgggcgtcgcgctg
ctcgccgcgacggacgatcatctgcggatgacgcgcgccggcacgctcgcgtatacgcgc
gaaccggccgcgacgccgtaccggccgtcggtcgacgtgttcttcaacagtctgaccgag
cactggtccggcaacgtgatcggcgtgctgctgacgggcatgggccgcgacggcgcgatc
gggctcaaggcgctgcggatgaagggctaccatacgatcgcgcaggacgaggcgacgagc
gccgtctacgggatgccgaaggcggccgcaacgctcggcgccgcgcgcgcgatcctgccg
ctcgagcgcatcgcgagcgaactcgcgacgctcgtgcgcatctga

DBGET integrated database retrieval system