KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04277Help
Entry
BMULJ_04277       CDS       T00740                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmj00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bmj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1209519..1210820)
Genome map
AA seq 433 aa AA seqDB search
MSNLIVHGGTPLRGDIKPSANKNAVLPILCATLLTDQPLRLIGVPDITDVRKILDIFRTL
GSDVSVDFTTGLLELHHRNTTFDPAVHRLPEAMRSSIMLIPPLLARFGVARLENDVKGCT
LGVREIDPHVEVFERFGAHIERTSDSLIVRADGPLTANDHWLDYASVTTTENFALCATAA
NGTSTLMNAASEPHVQEFCQFLAMIGVAVEGIGTSRLCVTGGSKLGGGEFRFAEDFHEIA
TFLALGAITGGDITVRNSSPEHFPLIDRTFAKFGVQVTHRDGWSRAERDGPLRVRRPFTQ
NILTKVEAAPWPYLPVDLLPIFIALGVRAEGSAMFWNKVYDGALGWSGELSKFGAHVLLS
DPHRLITFGGLQLTPARVESPYIIRVAIALLMVAASIEGRSEIMNALPIRRAHPRFVENL
RSVGANVEWTSSE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatctcatcgtccacggcggcaccccgctgcgcggggacatcaagccgtccgcg
aacaagaacgccgtcctgccgatcctctgcgcgaccctgctgaccgaccagccgctgcgg
ctgatcggcgtgccggacatcaccgacgtgcgcaagatcctcgatatcttccgcacgctc
ggcagcgacgtgtcggtcgatttcacgaccggcctgctcgaactccatcaccgcaatacg
accttcgacccggccgtccatcgcctgcccgaggcgatgcgctcgtcgatcatgctgatt
ccgccgctgctcgcgcgcttcggcgtcgcgcggctcgagaacgacgtgaaaggctgcacg
ctcggcgtacgcgaaatcgatccgcacgtcgaggtgttcgagcgcttcggcgcgcacatc
gagcgcacgtccgattcgctgatcgtccgcgccgacggcccgctgacggccaacgatcac
tggctcgactatgcgtccgtgacgaccaccgaaaacttcgcgctgtgcgcgacggcggca
aacggcacgtcgacgctgatgaacgcggcgtccgagccgcacgtgcaggagttctgccag
ttcctcgcgatgatcggcgtcgcggtcgagggcatcggcacgtcgcggctctgcgtgacg
ggcggcagcaagctcggcggcggcgagttccgcttcgccgaggatttccacgagatcgca
acgttcctcgcgctcggcgcgatcaccggcggcgacatcaccgtgcgtaactcgtcgccc
gagcactttccgctgatcgaccgcacattcgcgaagttcggcgttcaggtcacgcaccgc
gacggctggtcgcgcgccgagcgcgacggcccgctgcgcgtgcgccggccgttcacgcag
aacatcctcaccaaggtcgaagcggcgccgtggccgtacctgccggtcgatctgctgccg
atcttcatcgcgctcggcgtgcgcgccgaaggcagcgcgatgttctggaacaaggtctac
gacggcgcgctcggctggtccggcgagttgtcgaagttcggcgcgcacgtgttgctgtcg
gatccgcaccggctgatcacgttcggcgggctgcaactgacgccggcgcgtgtcgaaagc
ccgtacatcatccgcgtcgcgattgcactgctgatggtcgccgcgagcatcgaaggccgc
tccgaaatcatgaacgcgctgccgatccggcgcgcgcatccgcgtttcgtcgagaacctg
cgctcggtcggcgcgaatgtggagtggacgagcagcgagtaa

DBGET integrated database retrieval system