KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04300Help
Entry
BMULJ_04300       CDS       T00740                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_04300 (galM)
   00052 Galactose metabolism
    BMULJ_04300 (galM)
Enzymes [BR:bmj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BMULJ_04300 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1238168..1239256
Genome map
AA seq 362 aa AA seqDB search
MTFDTDSSRTASDVARTPSEPWGPLPGGDPVRRYTLRNAHGMRVVVSDLGATVVSWLAPD
RTGRFADIVLAHDTPADYLASGAYLGATVGRWANRIAGARFTLDGIDYPLDRNENGNLLH
GGASGFHRERWDVIDDRGGLTLRLDSPEGDAGFPGNVSVQVRYTLDDDGTLTIDYTGTSD
APTPLNLTNHSYFNLSGRAGSDVRGHVLRIDADAFLEVDDALIPTGRADVTGTAFDFRQS
APLGARLDWPHAQLARGRGFDHCYVLRDDVHGVRPVASIYDPESGRELTVSTDQCGLQLY
TGNYLDGLRVSGGTTCVRHAALCVEAGCFPNQINMAELADATIVRPGDTYRQTTRYRVAV
RA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgataccgattcttcccgcaccgcgtccgacgtcgcccgcactccgtccgag
ccgtggggtccgctgcccggcggcgatccggtgcggcgctatacgctgcgcaacgcgcac
gggatgcgcgtcgtcgtcagcgacctcggcgcgaccgtggtgtcgtggctcgcgcccgac
cgcaccggccgcttcgccgacatcgtgctcgcgcacgacacgccggccgactatctcgcg
tccggcgcgtatctcggcgcgacggtcggccgctgggcgaaccggatcgccggcgcgcgc
ttcacgctcgacggcatcgactatccgctcgatcgcaacgagaacggcaatctgctgcac
ggcggcgcaagcggctttcatcgcgaacgctgggacgtgatcgacgatcgcggcggcctc
acgctgcggctcgattcgcccgaaggcgacgcggggtttcccggcaacgtcagcgtacaa
gtgcgctatacgctcgacgacgacggcacgctgacgatcgactacacgggcacgagcgat
gcaccgacgccgctgaacctgacgaatcacagctacttcaatctgagcggccgcgcgggc
agcgacgtgcgcggccacgtgctgaggatcgatgcggacgcgtttctcgaagtcgacgac
gcgctgattccgaccggccgcgccgacgtgacgggcaccgcgttcgatttccggcaaagc
gcgccgctcggtgcgcgcctcgattggccgcacgcgcagctcgcgcgtggccgcggcttc
gatcactgctacgtgctgcgcgacgacgtgcacggcgtgcggccggtcgcgagcatctac
gatccggaaagcggccgcgagctgaccgtgtcgaccgatcaatgcgggctgcagctctat
accggcaactatctcgacggcctgcgcgtcagcggcggcacgacctgcgtgcggcatgcg
gcgctgtgcgtcgaggccggctgctttccgaatcagatcaacatggcggagctcgctgat
gccacgatcgtacggcccggcgatacgtatcggcagacgacgcgctatcgcgtcgccgtg
cgcgcgtaa

DBGET integrated database retrieval system