KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04720Help
Entry
BMULJ_04720       CDS       T00740                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bmj00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bmj00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1694898..1696193
Genome map
AA seq 431 aa AA seqDB search
MPVPQQAFLRDAMRRLNMTREAFANRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEI
VERAAPEGEIYTQRVDNHGLAKQFLFEGKPQLLSVDQFSRESVEALFRVADVMQPIARRH
KISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRV
MAGYVDALVIRHPEKGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKI
VDGAHIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIIDQIATNGHVIEQ
TNDLAAGLRGADVVYATRIQKERFTDESFEGYTPDFQINQALVDTVCKPDTLIMHPLPRD
SRPGANDLSTDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVENLVQHSMRDATWRPPAYL
GPEDAVFHGID
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttcctcagcaagccttcctccgcgacgcgatgcgccgcctcaacatgacgcgc
gaagcgttcgcgaaccgcatcggcgtgagccgccgtgcgctagatacctggctgctaccc
gacgattcgcaggaatcgcgcggcatgccggagatcgtcgagcggttcgtgtcggagatc
gtcgagcgcgcggcgccggaaggcgaaatctatacgcaacgcgtagataaccacggcctc
gcgaagcagttcctgttcgaaggcaagccgcaactgctgtcggtcgaccagttctcgcgc
gagtcggtcgaggcgctgttccgcgtcgccgacgtgatgcagccgatcgcgcgccgccac
aagatttcgcgcgtgctcgaaggcgcggtgctcggcaacctgttcttcgaagccagcacg
cgcacgcgcgtgtcgttcggcgcggcgttctgccggctcggcggctccgtctgcgacacg
accgggttcacgttctcgtcgatggcgaaaggcgagtcgatctacgatacgagccgcgtg
atggccggctacgtcgacgcgctcgtgatccgccatccggagaaaggctcggtcgccgaa
ttcgcgcgcgcgaccaatctgccggtgatcaacggcggcgacggtccgggcgagcatccg
agccaggcgctgctcgatctctatacgatccagcgcgaattctcgcggctcggcaagatc
gtcgacggcgcgcacatcgcgctcgtcggcgacctcaaatacggccggaccgtgcattcg
ctcgtcaagctgctcgcgctctaccgcgggctcaaattcacgctggtgtcgccgccgacg
ctcgaaatgcccgcctacatcatcgaccagatcgcgacgaacgggcacgtgatcgagcag
acgaacgacctcgcggcggggctgcgcggcgccgatgtcgtctatgcgacgcgaatccag
aaggagcgcttcaccgacgagtcgttcgaaggctatacgcccgatttccagatcaatcag
gcgctcgtcgacacggtctgcaaacccgacacgctgatcatgcatccgctgccgcgcgac
agccggcccggcgccaacgatctgtcgaccgacctgaaccgcgatccgcgtctcgcgatc
ttccggcagaccgacaacggcattccggtgcgcatggcgatctttgccgtgctgctcggc
gtcgaaaacctcgtgcagcattcgatgcgcgacgcgacgtggcgaccgccggcatacctg
gggccggaggatgccgtgtttcacgggatcgactga

DBGET integrated database retrieval system