KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04765Help
Entry
BMULJ_04765       CDS       T00740                                 

Gene name
asnB
Definition
glutamine-hydrolysing asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bmj00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1756907..1758874)
Genome map
AA seq 655 aa AA seqDB search
MCGIDGFLNSVAFDEETARGTLARMTASLAHRGPDAQGLWVDPAAGIALGHRRLAIVDLS
VHGRQPMASACGRYVMVFNGEIYNHRELRAQLERVGRAPAWRGHSDTEVLLAAFAAWGVD
ATLRRATGMFALALWNRESRVLTLARDRIGEKPLYYGRIGDALVFASELKALRAYPGFDG
EIDRDALCLYLRHSAVPAPHTIYRGIRKLPPGSWIQFEHAQDTPRIRTYWALEHAIDAGH
HEPFAGTAAEAVDRLDTVLRQAVARQMEADVPLGAFLSGGVDSSTIVALMQAQSAAPVDT
FTIGFHEAGYDEAGYAKAVARHLGTRHTELYVTADHALDVVPKLPAIYDEPFSDASQIPT
FLVAELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWRKLHRVPAAVRTRIAGALHALRP
DHADQLAAVAQGAWGGGELRESATRIGDRLHKLGHVMTADSRIGLYRLLMSSVHHPERIA
LAGHEPPTPLDTVSAWPAHLSFAEQAMAIDTLTYLPTDILTKVDRAAMAVSLETRMPFLD
HHVVEFAWRLPASLRLPEGQSKALLRRLLDRYVPTELIDRPKQGFCAPIDHWLRGALRDW
ADALLQPSRLRDEGFFDAAAVERLWRQHQTGRMNWQHQLWTVLMFQAWLDAQRAA
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgacggctttctgaatagcgtcgccttcgatgaggagacagcgcgcggc
acgctcgcgcggatgacggcgagcctcgcgcatcgcggaccggacgcacagggcttgtgg
gtcgatccggcggccggtatcgcgctcggtcaccggcggctcgcgatcgtcgacctgtcg
gtgcacggccggcagccgatggcgtcggcgtgcggccgctacgtgatggtcttcaacggc
gagatctacaaccaccgcgaactgcgcgcgcagctcgagcgcgtcggacgcgcgcccgcg
tggcgcggtcattccgacaccgaagtgctgctcgccgcgttcgccgcgtggggcgtcgac
gcgacgttgcggcgcgcgaccgggatgttcgcgctcgcgctgtggaaccgcgagtcgcgc
gtgctgacgctcgcgcgcgaccgcatcggcgagaaaccgctgtattacgggcggatcggc
gatgcgctcgtattcgcgtcggagctgaaggcgctgcgcgcctatccggggttcgacggc
gagatcgatcgcgacgcgctgtgcctgtatctgcggcattccgcggtgcccgcgccgcat
acgatctatcgcggcatccgcaagttgccgcccggcagctggatccagttcgagcatgcg
caggacacgccgcgaatccgcacgtactgggcgctcgagcacgccatcgatgccggccat
cacgagccgttcgcaggcaccgcggccgaggccgtcgaccggctcgacacggtgctgcgg
caggccgtcgcgcggcagatggaagccgacgtgccgctcggcgcgttcctgtcgggcggc
gtcgattcgtcgacgatcgtcgcgctgatgcaggcgcagtccgccgcgcccgtcgacacg
ttcacgatcggttttcacgaagcgggctacgacgaggccggctatgcgaaggccgtcgcg
cgccatctcggcacgcgccataccgagctgtacgtgacggccgatcatgcgctcgacgtc
gtgccgaagctgccggccatctacgacgagccgttctccgacgcgtcgcagattccgacc
ttcctcgtcgcggaactgacgcgccggcacgtgaaggtcagcctgtccggcgacggcggc
gacgagctgttcggcggctatacgcgctacttcctgacgccgcgcctctggcgcaagctg
catcgcgtgccggcggccgtgcgtacgcggatcgccggcgcgctgcacgcgctgcgaccc
gatcatgcggaccagctcgcggctgtcgcgcaaggcgcgtggggcggcggcgaactgcgc
gaatcggcgacgcgcatcggcgaccggctgcacaagctcggccacgtgatgacggccgac
agccggatcgggctgtaccggctgctgatgtcgtcggtccatcatccggagcgcatcgcg
ctcgccgggcacgagccgccgacgccgctcgatacggtatccgcatggcccgcgcatctg
agctttgccgagcaggcgatggcgatcgacacgctcacctatctgccgaccgacatcctg
acgaaggtcgaccgcgcggcgatggcggtcagcctcgaaacgcggatgccgttcctcgat
catcacgtcgtcgaattcgcgtggcggctgcccgcatcgctgcgcttgcccgaagggcag
tcgaaggcgctgctgcgccggctgctcgaccggtacgtgccgaccgagctgatcgaccgg
ccgaagcagggcttctgcgcgccgatcgatcactggctgcgcggcgcgctgcgcgactgg
gccgacgcgttgctgcagccgtcgcggctgcgcgacgagggcttcttcgacgcggccgcg
gtcgagcggctgtggcgccagcatcagacggggcgcatgaactggcagcatcagctgtgg
accgtgctgatgttccaggcgtggctcgacgcgcagcgcgccgcctga

DBGET integrated database retrieval system