KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04860Help
Entry
BMULJ_04860       CDS       T00740                                 

Gene name
acs
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bmj01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmj00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bmj00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bmj00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bmj00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1873917..1875623)
Genome map
AA seq 568 aa AA seqDB search
MTVQAFLDARDFLLRHRTDYETAYRDFAWPVLDTFNWALDYFDPMARGNDRPALWIVDGA
TGTGEPYSFAQMSERSSRIANWLRGIGVGRGDRILLMLPNRVELWDAMLAAMKLGAIVLP
ATTQLSADDVRDRVQIGGAKYAIVDENETAKFEQPGLGLAQRIVAGAPRDGWLAMNDGYA
ASGAFEPDAVTHANDPMLLYFTSGTTSKPKLVEHTHRTYPVGHLSTMYWIGLQPGDIHWN
ISSPGWAKHAWSCFYAPWNAQACVFAFNYARFEAKAVLDALVKYRVTTLCAPPTVWRMLV
QQPLASFDVALREIVGAGEPLNPEIIERVKKAWGITIRDGYGQTETTCLIGNSPGQPVVA
GSMGRPLPGYRIALLDPDGAPVSEGEVALPLDADGARPVGLMTGYANNRDATAHAMRDGH
YRTSDIAMRRDDGYYVYIGRADDVFKSSDYRLSPFELESVLIEHPAIAEAAVVPSPDPVR
LSVPKTYITLRQGYEESAALALEIFRFSRDKLAPYKRIRRLQFAELPKTISGKIRRVELR
RREIERGDDATARMPGEYWEDDFSAELK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacggtacaggcattcctggacgcacgcgattttctgctgcgccaccgcaccgactac
gaaaccgcctatcgcgatttcgcatggccggtgctcgacacgttcaactgggcgctcgac
tacttcgatccgatggcgcgcggcaacgaccggcccgcgctctggatcgtcgacggcgcg
accggcaccggcgagccgtattcgttcgcgcagatgtccgaacgctcgtcgcggatcgcg
aactggctgcgcggcatcggcgtcgggcgcggcgaccggatcctgctgatgctgccgaac
cgcgtcgagctctgggacgcgatgctcgccgcgatgaagctcggcgcgatcgtgctgccc
gcgacgacgcagctgtcggccgacgacgtgcgcgaccgcgtgcagatcggcggcgcgaaa
tacgcgatcgtcgacgagaacgaaaccgcgaagttcgagcagccggggctcggcctcgcg
cagaggatcgtcgcgggcgcgccgcgcgacggctggctcgcgatgaacgacggctacgcg
gcgagcggcgccttcgagcccgacgccgtcacgcatgcgaacgatccgatgctgctgtat
ttcacgtcgggcacgacgtcgaagccgaagctcgtcgagcatacgcaccgtacctatccg
gtcggtcatctgtcgacgatgtactggatcgggctgcagccgggcgacatccactggaac
atcagctcgccgggttgggccaagcacgcgtggagctgcttctacgcgccgtggaacgcg
caggcctgcgtgttcgcgttcaactatgcgcgcttcgaggcgaaggccgtgctcgacgcg
ctcgtcaaataccgcgtgacgacgctgtgtgcgccgccgacggtatggcggatgctcgtg
cagcagccgctcgcgtcgttcgacgtggcgctgcgcgagatcgtcggcgcgggcgagccg
ctgaatccggaaatcatcgagcgcgtgaagaaggcgtggggcatcacgatccgcgacggc
tacggccagaccgagacgacctgcctgatcggcaactcgccgggccagccggtcgtcgcc
ggatcgatgggccggccgctgcccggctatcggatcgcgctgctcgatcccgacggcgca
ccggtgagcgagggcgaggtcgcgctgccgctcgacgcggacggcgcgcgcccggtcggc
ctgatgaccggctatgcgaacaaccgcgacgcgaccgcgcacgcgatgcgcgacggtcac
taccggacatcggacatcgcgatgcgtcgcgacgacggctactacgtctatatcggccgc
gcggacgacgtgttcaagtcgtccgactaccggctgagcccgttcgagctcgaaagcgtg
ctgatcgagcatccggcgatcgccgaagcggccgtcgtgccgagccccgatccggtgcgg
ctgtcggtgccgaagacgtacatcacgctgcggcagggctacgaggaaagcgcggcgctc
gcgctcgagatcttccggttctcgcgcgacaagctcgcgccgtacaagcgcatccgccgg
ctgcagttcgccgagctgccgaagacgatctccgggaagattcgccgcgtcgagctgcgc
cgccgcgaaatcgagcgcggcgacgacgcgaccgcacgcatgcccggcgaatactgggaa
gacgatttttccgccgaactgaaatga

DBGET integrated database retrieval system