KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04978Help
Entry
BMULJ_04978       CDS       T00740                                 

Gene name
fdhA2
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMULJ_04978 (fdhA2)
  Energy metabolism
   00680 Methane metabolism
    BMULJ_04978 (fdhA2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMULJ_04978 (fdhA2)
Enzymes [BR:bmj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BMULJ_04978 (fdhA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2002924..2004120)
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGKVEVQKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKIGDLVSVPFNVACGRCAMCKETHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHAKAMGFETVDLSKD
ATLGEQIAQILGKPEIDCAVDCVGFEAHGHGSSGHAEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAQDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILYDRLPIA
KIVNVTVISLDDAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttgggccgggcaaggtcgaggtgcagaagatc
gattatccgaagatggtcgacccgagcggccgcgcaatcggacacggcgtgatcctgaag
gtcgtcagcacgaacatctgcggctcggaccagcacatggtgcgcggccgcacgacggcg
ccggtcggtctcgtgctcggtcacgagatcacgggcgaggtcgtcgaggtcggtcgcgac
gtcgagacgctgaagatcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggaaacgcatacgggcgtgtgcctgaacgtgaacccgtcgcgcgcg
ggcggcgcgtacggctacgtcgacatgggcggctggatcggcggccaggccgaatacgtg
ctcgtgccgtatgccgacttcaacctgctgaaattcccggaccgcgatcaggcgatggcg
aagatccgcgatctgacctgcctgtccgacattctgccgaccggttatcacggcgcggtc
agcgccggcgtgaagccgggctcgaccgtctacatcgcgggcgcgggcccggtcgggatg
gcggcggccgcctcggcgcgcctgctcggcgcggccgtgacgatcgtcggcgacatgaac
gcggaacgcctcgcgcatgcgaaggcgatgggcttcgagacggtcgacctgtcgaaggac
gcgacgctcggcgaacagatcgcgcagatcctcggcaagccggagatcgactgcgcggtc
gactgcgtcggcttcgaggcgcacggccacggctcgtcgggccatgcggaagaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcggccggccggtgcgatcggcattccg
ggcctgtacgtgacggacgatccgggcgcgcaggacaaggccgcgcagcacggcagcctg
agcatccgcttcggtctcggctgggcgaagtcacattcgttcttcacgggccagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgtacgaccgcctgccgatcgcg
aagatcgtcaacgtgacggtgatctcgctcgacgacgcgcccgaaggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtgatcgatccgcacgggctgctcgcggcctga

DBGET integrated database retrieval system