KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05080Help
Entry
BMULJ_05080       CDS       T00740                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMULJ_05080 (speB)
Enzymes [BR:bmj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     BMULJ_05080 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2135775..2136731
Genome map
AA seq 318 aa AA seqDB search
MNDHTHFQPLGGNEMPRCGGIATMMRLPHVASAAGLDACFVGVPFDLGTSNRTGARFGPR
QIRTESVLLRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKP
ITLGGDHTIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLH
GDKVTQIGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAPLMDEVRERVGDTPVYISF
DIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGARGLNIVGCDLVEVAPPYDPFGTTALLG
ANLAYELLCVLPGVAYRD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccacacccatttccagccgctcggcggcaatgaaatgccgcgctgcggcggc
atcgcgacgatgatgcgcctgccgcacgtggcgagcgccgccggcctcgacgcctgcttc
gtcggcgtgccgttcgatctcggcacgtcgaaccgcaccggcgcacgcttcggcccgcgc
cagatccgtaccgaatccgtgctgctgcgcccgtacaacatggcgacgcgcgccgcgccg
ttcgattcgctgcagatcgccgacatcggcgacgtcgcgatcaatccgtacaacctgcac
gattcgatcgcgcgcatcgaagccgcgtacgacgcgatcctcgagcacgactgcaagccg
atcacgctcggcggcgatcatacgatcgcgctgccgatcctgcgcgcgatccaccgcaag
cacggcaaggtcgcattgatccacgtcgatgcgcacgccgacgtgaacgatacgatgatg
ggcgaaaagatcgcgcacggcacgccgtttcgccgcgcggtcgaggaaggcctgctgcac
ggcgacaaggtcacgcagatcggcctgcgcggcaccggctacgcagccgaagacttcgac
tggtgccgcgagcagggtttccgcgtcgttcaggcggaagaatgctggaacaagtcgctc
gcgccgctgatggacgaagtgcgcgagcgtgtcggcgacacgcccgtctacatcagcttc
gacatcgacggcatcgatcccgcctacgcaccgggcaccggcacgcccgaaatcgcgggc
ctcacggtgccgcaggcgctcgagatcatccgcggcgcgcgcgggctgaacatcgtcggc
tgcgatctcgtcgaagtcgcgccgccgtacgacccgttcggcacgacggcactgctcggc
gcgaacctcgcatacgagctgctgtgcgtgctgccgggcgtcgcgtaccgcgactga

DBGET integrated database retrieval system