KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05269Help
Entry
BMULJ_05269       CDS       T00740                                 

Definition
dihydroflavonol-4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
Enzymes [BR:bmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BMULJ_05269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2344549..2345556
Genome map
AA seq 335 aa AA seqDB search
MTDTSRDLVLVTGASGFVGSAVARIAQQKGYAVRVLVRPTSPRTNVADLDAEIVTGDMRD
ETSMRAALRGVRYLLHVAADYRLWAPDPHEIERANLEGAVATMRAARAEGVERIVYTSSV
ATLKVTSAGDPADENRPLTPEQAIGVYKRSKVLAERAVERMIADEGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAHGHFLALERGRIGERYILGGENL
PLQQMLADIAQMTGRKAPTIALPRWPLYPLAVGAEAVAKFTKKEPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYRDGLRDALDWFRGAGYLK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacctcccgcgatctcgttctcgtcaccggcgcgtccggtttcgtcggctcg
gctgtcgcgcgcatcgcgcagcagaaaggctatgcggtgcgtgtgctggtgcgcccgacg
agcccgcgcacgaacgtcgccgatctcgacgccgagatcgtcaccggcgacatgcgcgac
gagacgtcgatgcgcgccgcgctgcgcggcgtgcgctacctgctgcacgtcgcggccgac
taccggctgtgggcgccggacccgcacgagatcgaacgcgcgaacctcgaaggcgccgtc
gcgacgatgcgcgccgcgcgcgccgaaggcgtcgagcggatcgtctatacgagcagcgtc
gcgacgctgaaggtcacgagcgccggcgatccggccgacgagaaccggccgctcacgccc
gagcaggcgatcggcgtgtacaagcgcagcaaggtgctcgccgagcgtgcggtcgagcgg
atgatcgccgacgaagggctgcccgcggtgatcgtcaacccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccgcatcatcgtcgaggccgcgctcggcaagatt
ccggcgttcgtcgatacggggctgaacctcgtgcatgtcgacgacgtcgcgcacggccac
ttcctcgcgctcgagcgcggccggatcggcgagcgctacatcctgggcggcgagaacctg
ccgctgcagcagatgctcgccgacatcgcgcagatgacgggccgcaaggcgccgacgatc
gcgctgccgcgctggccgttgtacccgctcgcggtcggcgccgaggcggtcgcgaagttc
acgaagaaggagccgttcgtcacggtcgacgggctgcggatgtcgaagaacaagatgtat
ttcacgtccgcgaaggccgagcgcgaactcggctaccgcgcgcggccgtaccgcgacggg
ctgcgcgacgcgctcgactggttccgcggcgcgggctacctgaagtag

DBGET integrated database retrieval system