KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05269Help
Entry
BMULJ_05269       CDS       T00740                                 

Definition
dihydroflavonol-4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2344549..2345556
Genome map
AA seq 335 aa AA seqDB search
MTDTSRDLVLVTGASGFVGSAVARIAQQKGYAVRVLVRPTSPRTNVADLDAEIVTGDMRD
ETSMRAALRGVRYLLHVAADYRLWAPDPHEIERANLEGAVATMRAARAEGVERIVYTSSV
ATLKVTSAGDPADENRPLTPEQAIGVYKRSKVLAERAVERMIADEGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAHGHFLALERGRIGERYILGGENL
PLQQMLADIAQMTGRKAPTIALPRWPLYPLAVGAEAVAKFTKKEPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYRDGLRDALDWFRGAGYLK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacctcccgcgatctcgttctcgtcaccggcgcgtccggtttcgtcggctcg
gctgtcgcgcgcatcgcgcagcagaaaggctatgcggtgcgtgtgctggtgcgcccgacg
agcccgcgcacgaacgtcgccgatctcgacgccgagatcgtcaccggcgacatgcgcgac
gagacgtcgatgcgcgccgcgctgcgcggcgtgcgctacctgctgcacgtcgcggccgac
taccggctgtgggcgccggacccgcacgagatcgaacgcgcgaacctcgaaggcgccgtc
gcgacgatgcgcgccgcgcgcgccgaaggcgtcgagcggatcgtctatacgagcagcgtc
gcgacgctgaaggtcacgagcgccggcgatccggccgacgagaaccggccgctcacgccc
gagcaggcgatcggcgtgtacaagcgcagcaaggtgctcgccgagcgtgcggtcgagcgg
atgatcgccgacgaagggctgcccgcggtgatcgtcaacccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccgcatcatcgtcgaggccgcgctcggcaagatt
ccggcgttcgtcgatacggggctgaacctcgtgcatgtcgacgacgtcgcgcacggccac
ttcctcgcgctcgagcgcggccggatcggcgagcgctacatcctgggcggcgagaacctg
ccgctgcagcagatgctcgccgacatcgcgcagatgacgggccgcaaggcgccgacgatc
gcgctgccgcgctggccgttgtacccgctcgcggtcggcgccgaggcggtcgcgaagttc
acgaagaaggagccgttcgtcacggtcgacgggctgcggatgtcgaagaacaagatgtat
ttcacgtccgcgaaggccgagcgcgaactcggctaccgcgcgcggccgtaccgcgacggg
ctgcgcgacgcgctcgactggttccgcggcgcgggctacctgaagtag

DBGET integrated database retrieval system