KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05319Help
Entry
BMULJ_05319       CDS       T00740                                 

Gene name
araF
Definition
(GenBank) ABC-type sugar transport system periplasmic component
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_1 Peripla_BP_4 Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: BAG47157
UniProt: A0A0H3KXM1
Position
2:complement(2399071..2400075)
Genome map
AA seq 334 aa AA seqDB search
MFRTNRRTLLRALLAALCIAPLGMQGTARADAPLKIGFLVKMPEQAWFINEQNAAAALGQ
KENFSVVKIGTPDGEKVLAAIDNLGSQGAQGFVICAPDVRLGPAIAARAKRYNMKFVTVD
DQLVDSTGKPLANVPHLGMSATKIGNQVGQAIADEMKRRGWKPEEVGALRITNYELPTAK
LRTDGATQALLANGFRKENIFDAPQKTTDDEGGFSAAAPVLARHPNVKKWVIYALNEETV
LGAVRATEQLHIPAADVIGVGINGAGEAFAEFQKKEPTGFFGTIAVSSTNHGKESTQNLV
DWIRNGKMPPADTQTSGKLMTRSNWQAVRAELGI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcacgaatcgcagaaccctgttgcgcgcgctgctggccgcgctgtgcatcgcg
ccgctcggcatgcagggcacggcccgcgccgatgcgccgctgaagatcggtttcctcgtc
aagatgcccgagcaggcctggttcatcaacgaacagaacgcggcggccgcgctcggtcag
aaggagaatttctcggtcgtgaagatcggcacgccggacggcgagaaggtgctggccgcg
atcgacaacctcggctcgcaaggcgcgcagggcttcgtgatctgcgcgcccgacgtgcgg
ctcgggccggcgatcgccgcgcgcgcgaagcgctacaacatgaagttcgtgaccgtcgac
gaccagctcgtcgattcgaccggcaagccgctcgcgaacgtgccgcacctcggcatgtcg
gcgacgaagatcggcaaccaggtcggccaggcgatcgccgacgagatgaagcggcgcggc
tggaagccggaggaagtcggcgcgctgcgcatcacgaactacgaactgccgaccgcgaag
ctgcgcactgacggcgccacgcaggcgctgctcgcgaacggcttccgcaaggagaacatc
ttcgacgcaccgcagaagacgaccgacgacgaaggcggcttcagcgcggcggcgccggtg
ctcgcgcgccatccgaacgtgaagaagtgggtgatctacgcgctgaacgaggaaaccgtg
ctcggcgccgtgcgcgcgaccgaacagctgcacattccggcggccgacgtgatcggcgtc
ggcatcaacggtgcgggcgaggcgttcgcggaattccagaagaaggagccgaccggcttc
ttcggcacgatcgcggtcagctcgacgaatcacggcaaggaaagcacgcagaacctcgtc
gactggatccgcaacggcaagatgccgcccgccgatacgcagacgagcggcaagctgatg
acgcgcagcaactggcaggcggtgcgcgccgagctcggcatctga

DBGET integrated database retrieval system