KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05322Help
Entry
BMULJ_05322       CDS       T00740                                 

Definition
(GenBank) permease of the major facilitator superfamily
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_4
Motif
Other DBs
NCBI-ProteinID: BAG47160
UniProt: A0A0H3KU62
Position
2:complement(2402056..2403432)
Genome map
AA seq 458 aa AA seqDB search
MTTTQHTSAASAAAPSGPAAAVDERQLMGLLTRRLVPFLALIYVVAYVDRTVVGFAKLHM
NAAVGLSDAAYGLGAGLFFIGYFLCEVPSNLALGRFGARVWFARILATWGVITMAMALVR
GPTSFYVLRFLLGAAEAGLYPGILYFLTQWFPMRDRARVIGLLVLAQPVAGIVTGPLAGW
LLSTHGLFGLSNWQTLFVASGLPAVLLVWPTLRVLPESPERARWLDDAQRRWIARELAAD
RDTYRPDAHRNPLAALRDRRVLLLAALFLPFPLCIYGLSLWLPTIIKAFGTGDAATGLLS
AVPYLFAVVGLLVVPRHSDRTRERYAHIVVVSAAAALTMAASASVRQPALQFLFICLTAF
SLYSIQAVVWALPGEFLTGTSAAVGIAAINSLANLGGYVGPYGIGLIKQATGSLAAGLYF
LAATLLFAVLITFAVRAALRAPQRAGDALARESRPLSG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacgcagcacacgtccgcggcatcggccgcggccccgtccggcccggcggca
gccgtcgacgaacggcaactgatgggactgctcacgcgcaggctcgtgccgtttctcgcg
ctgatctacgtggtcgcgtatgtcgaccgcacggtggtcggcttcgcgaagctgcatatg
aacgcggccgtcgggctcagcgacgcggcatacgggctcggcgcgggcctgttcttcatc
ggctacttcctgtgcgaagtgccgagcaacctcgcgctcggccgcttcggtgcgcgcgtg
tggttcgcgcggattctcgcgacgtggggcgtgatcacgatggcgatggcgctggtgcgc
ggccccacgagcttctacgtgctgcgctttctgctcggcgcggcggaagccggactgtat
ccgggcatcctctatttcctgacgcagtggtttccgatgcgcgaccgcgcgcgcgtgatc
ggactgctcgtgcttgcgcagccggtcgccggcatcgtgaccggcccgctcgcaggctgg
ctgctgtcgacgcacggcctgttcggcctgtcgaactggcagacgctgttcgtcgcgagc
gggctgccggccgtgctgctcgtgtggccgacgctgcgcgtgctgcccgagtcgccggag
cgcgcgcgctggctcgacgacgcgcagcgccgctggatcgcgcgcgagctcgcggccgac
cgcgacacctaccggcccgacgcgcatcgcaatccgctcgcggcgctgcgcgaccggcgc
gtgctgctgctcgcggcgctgttcctgccgttcccgctctgcatctacgggctgtcgctc
tggctgccgacgatcatcaaggcgttcggcaccggcgacgcggcgaccgggctgctgtcg
gccgtcccgtacctgttcgccgtggtcgggctgctcgtcgtgccgcgccattccgatcgg
acgcgcgagcgctatgcgcacatcgtcgtcgtgtcggccgcggcggcgctgacgatggcg
gccagcgcgtcggtgcggcagcccgcgctgcagttcctgttcatctgcctgaccgcgttt
tcgctctattcgattcaggccgtcgtgtgggcgctgcccggcgaattcctgacgggcacg
agcgcggcggtcggcatcgcggcgatcaactcgctcgcgaatctcggcggctacgtcggg
ccgtacggcatcggcctgatcaagcaggcgaccggcagtctcgctgccggcctgtacttc
ctcgcggcgacgctgctgttcgccgtgctgatcacgttcgcggtgcgcgcggcgctgcgt
gcgccgcagcgcgcgggcgacgcgctcgcgcgcgaatcgcggccgctttccggctga

DBGET integrated database retrieval system