KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05329Help
Entry
BMULJ_05329       CDS       T00740                                 

Definition
(GenBank) putative multiple sugar transport system substrate-binding protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:2413422..2414681
Genome map
AA seq 419 aa AA seqDB search
MTHRPVRAAARFATAAAVALASLAATAPADAGTLSINIAFKGASQRAVWQSTLDAFHRAH
PDIDVKATFVDEEAYKVQLPAWLTTVAPDVVNWHAGERMAYYAKRGLFEDLSGDWAKNGW
DAMYASTRSASSYNGKQYAAPTVYYSWGLFYRKDLFRKVGIANEPKTWDQFLDACRKLKA
AGITPIAVGGRDAWTLAGWFDYLDLRLNGNAFHQQLMAGDVPYTDARVKKVYTTWKSLID
AGYFIDNALSYDLDGAQPFLFQGKAAMMLMGTFIAAGFPANVKPEMGYYRFPIIDANVPT
AEDGPVESLHIPTKAKNKADAHTFLAFVETPEIGAKLAEGLGSLSANSKSPEPAEPISRI
GFRILADTKGGVAQFYDRDMTKEMADEGMKGMQQFVANPAQLDAVLAQLEQTRKRIYKK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgactcatcgccccgttcgcgccgccgcccggttcgccacggccgccgccgtcgcactc
gcgtcgctcgccgcgaccgcacccgccgacgccggcacgctgagcatcaacatcgcgttc
aaaggcgcgagccagcgcgcggtctggcagtcgacgctcgacgcgttccaccgcgcgcat
ccggacatcgacgtgaaagcgacgttcgtcgacgaggaagcgtacaaggtgcagcttccc
gcgtggctcacgaccgtcgcgcccgacgtcgtgaactggcacgcgggcgaacggatggcg
tactacgcgaagcgcgggctgttcgaggatctgagcggcgactgggcgaagaacggctgg
gacgcgatgtacgcctcgacgcgcagcgcgtcgtcgtacaacggcaagcaatacgcggcg
ccgaccgtctactactcgtggggcctgttctaccggaaggatctgttccgcaaggtcggc
atcgcgaacgagccgaaaacctgggaccagtttctcgatgcgtgccgcaagctgaaggct
gcgggcatcacgccgatcgcggtcggcggccgcgacgcgtggacgctcgccggctggttc
gactatctcgacctgcgcctgaacggcaacgcgttccatcagcagctgatggccggcgac
gtgccgtacaccgacgcgcgcgtgaagaaggtctatacgacgtggaaatcgctgatcgat
gccggctacttcatcgacaacgcgctgtcctacgatctcgacggcgcgcagccgttcctg
ttccagggcaaggccgcgatgatgctgatgggcacgttcatcgcggccggctttccggcg
aacgtgaagccggagatgggctactaccgctttccgatcatcgacgcgaacgtgccgacc
gccgaagacggcccggtcgaatcgctgcacattccgacgaaggcgaagaacaaggccgac
gcgcatacgttcctcgcgttcgtcgaaacgccggagatcggcgcgaagctcgcggaaggg
ctcggctcgctgtcggcgaacagcaagtcgccggagccggccgagccgatctcgcgcatc
ggcttccggattctcgccgacacgaagggcggcgtcgcgcagttctacgaccgcgacatg
acgaaggaaatggccgacgaagggatgaagggcatgcagcagttcgtcgcgaatcccgcg
cagctcgatgcggtgctcgcgcagctcgagcagacgcgcaagcggatctacaagaagtga

DBGET integrated database retrieval system