KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05331Help
Entry
BMULJ_05331       CDS       T00740                                 

Gene name
malG
Definition
(GenBank) multiple sugar transport system permease protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:2415690..2416541
Genome map
AA seq 283 aa AA seqDB search
MFPTPVAQWKPVTRRLYKLSLPVALAIWLLPLIAVFVTSVRSTEELVEGHYWGWPRHFSM
IENYRDALTTSPMLHYFWNSVQITVPSVLGSIALAAMAGFALATYRFRGNTALFGTFVAG
NFVPVRVLMIPVRDLSLRLGVFNTVEALILFHVAFQTGFCTLFLRNFIKQLPFELIEAAR
IEGAGEWTVFWRIVLPLIRPALAALAILVFTFVWNDYFWALCLTQGDEAAPITAGVAALK
GQWTTSWNLVSAGSILAALPSVAMFFAMQKHFVAGLTFGATKG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgacacccgtcgcccaatggaaacccgtcacgcgccggctgtacaagctgtcg
ctgcccgtcgcgctcgcgatctggctgctgccgctgatcgcggtgttcgtcacgtcggtg
cgctcgaccgaagagctcgtcgaaggccattactggggctggccgcgccatttctcgatg
atcgagaactatcgcgacgcgctgacgacgtcgccgatgctgcactacttctggaacagc
gtgcagatcaccgtgccgtccgtcctcggctcgatcgcgctcgccgcgatggcgggcttc
gcgctcgcgacctaccggtttcgcggcaataccgcgctgttcggcacgttcgtcgccggc
aacttcgtgccggtgcgggtgctgatgattccggtgcgcgacctgtcgctgcggctcggc
gtcttcaatacggtcgaggcgctgatcctgtttcacgtcgcgtttcagaccggcttctgc
acgctgttcctgcgcaacttcatcaagcagctgccgttcgagctgatcgaggccgcgcgc
atcgaaggcgccggcgagtggacggtgttctggcgcatcgtgctgccgctgatccggccg
gcgctggccgcgctcgcgattctcgtgttcacgttcgtctggaacgattacttctgggcg
ctgtgcctgacgcagggcgacgaggccgcgccgattactgcgggtgtcgccgcgctgaag
ggacagtggacgacgtcgtggaacctcgtgtcggccggctcgattctggcggcgctgccg
tcggtcgcgatgttcttcgcgatgcagaagcatttcgtcgcggggctgacgttcggcgcg
acgaaaggctga

DBGET integrated database retrieval system