KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05332Help
Entry
BMULJ_05332       CDS       T00740                                 

Gene name
cheR
Definition
(GenBank) chemotaxis protein methyltransferase
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj02020  Two-component system
bmj02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMULJ_05332 (cheR)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BMULJ_05332 (cheR)
Enzymes [BR:bmj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     BMULJ_05332 (cheR)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BMULJ_05332 (cheR)
Two-component system [BR:bmj02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BMULJ_05332 (cheR)
Bacterial motility proteins [BR:bmj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BMULJ_05332 (cheR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheB_methylest PAS_10 HATPase_c Response_reg PAS_4 PAS_9 PAS CheR_N HisKA PAS_3 PAS_8 CENP-F_leu_zip Golgin_A5 IFT57 HMMR_N HATPase_c_2 Methyltransf_12 GAS Sec8_exocyst IncA TSNAXIP1_N Sec20 Spc7 FTA4 APG6 Leu_zip TPR_MLP1_2 Exonuc_VII_L UPF0449 HAUS-augmin3 DUF3450 HATPase_c_3 MAD V_ATPase_I DUF1664 FimP AAA_23 TBPIP Baculo_PEP_C Fusion_gly FapA DUF1043 DASH_Duo1 bZIP_1 MCC-bdg_PDZ Fez1
Motif
Other DBs
NCBI-ProteinID: BAG47170
UniProt: A0A0H3KU72
Position
2:2416868..2421010
Genome map
AA seq 1380 aa AA seqDB search
MARQEPTDRERLPASATLRSDLTFPIVGIGASAGGTTALQTFFENAPTGMEMAFVVIVHL
APEQISHMDSVLQHTTGMPVRQVTSTVPIEKNHIYVIAPGMQLEMADGCLRCSPREMSGG
VALTIDHFFRTLADAHDSRAIGIVMSGTGSDGAAGLRRIKEVGGITLAQTPDDAEHAEMP
KQAIAVGGADIVLPAAEMPQRLLDLWANARRIEQQGLELAHAHQNLDRPGANDPERALSD
ILMHLRVRTGHDFRLYKRATVLRRIERRMQVNGQRDLLAYRDFLRATPDEANALLADMLI
GVTQFFRDRDAFDFLEREVIASMFSPDAGEEQVRVWVAGCATGEEAYSISLLLARARETA
VSSQAIQVFATDIDEAAIVRARTGSYPLSIAADVPEPLLQRYFTRDGAHFVIAKSVRERI
LFAAHSLLRDPPFSHLDLISCRNVLIYLERAVQRQILELFHFALRPNGYLFLGTAESADA
ADDLFTVVDKKRRIYQARVVTHRAKTPTGCPPLLHVESGSADERPVPTPALRAPASPVQR
NFSYAELHQRALEMYSPPSVIIDKESNVVHLSDNAGRFLRHVGGELSSNIMTLVLPDLRL
DLRTAIFRALQTGTSVEARRVKWTHDTQVSWINMTVRPFHDKVANADFLLVVFDEVAGRM
TDEDQAEATGQDPVLAQLEHELQHSREQLATIIEQYETSVEELKASNEELQAINEELRST
SEELESSKEELQSVNEELTTANAEMQARIEDTAKANDDLHNIIASSEIATVFVDKEIRIK
RFTPNATAIFNLIDSDLGRSLFHITHSLRYPTLADDVRQSFQSLRLIEREIESEAGRWYL
IRLLPYRTADDHIDGAVITLIDVTDRHHAEEAARAGEQRLRLVAQSTKDYAIIIQDGNGI
IASWNAGAERIFGYTEDEMIGQDVELIYEPNDRHARVPAHEREVAAREGRADDERWHRTK
DGRRIFCSGVVTPIADTSFNGFAKIVRDLTQRKLSEDANREALAREQAAREQALSSNQLK
DEFIAVLSHELRHPLNLIGVRAEMLPRLPETRDIPAVREAAELIRQAVRAQAQIIDDLLD
LSRIRTGKLALELSRVDLTAVLRTIVDTCEADAHARGLVLTAELPDEPAIALADPIRCEQ
IFWNLMSNALKFTHAGGRIVVRLTHEARMLRVDVIDDGQGIDRDTLPHVFDMFRQAPRDR
TRGGLGIGLALVRQLVEMHDGRISAASEGPGRGTTMTVWLPAAADTRVAAADRRASEGRI
AGLHVLLVEDDAETALSLTTLLKLAGAEVRTAASGAAALEMLAQGPVDAIVSDIGLPDMD
GYALLRRIKADPQWAQVKAIALTGRNRQTDVGAATQAGFDTHLPKPLDFGLLLAALAEPR
NT seq 4143 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcaagagcctaccgatcgggagcggcttcccgcgtctgcgacgttgcgaagc
gatctgacgtttccgatcgtgggcatcggcgcatcggcaggcggcacgacggccttgcag
accttcttcgagaacgcgccgaccggcatggaaatggcgttcgtcgtcatcgtccatctg
gccccggagcagatcagccacatggacagcgtgctgcagcacacgaccggcatgccggtc
cgtcaggtgacgagcaccgtcccgatcgaaaagaaccatatctacgtgatcgcgcccggc
atgcagctcgaaatggcggacggctgcctgcgttgcagcccgcgcgagatgtcgggcggc
gtcgcgctgacgatcgaccactttttccggacgctggccgacgcgcacgattcgcgcgcg
atcggcatcgtgatgtccgggacgggctccgacggcgcggcggggctgcgccgcatcaag
gaagtcggcggcatcacgctcgcgcagacgcccgacgatgccgaacacgccgagatgccg
aagcaggcgattgcggtcggcggcgccgatatcgtgctgcccgccgccgaaatgccgcaa
cggctgctcgatctctgggccaacgcgcggcgcatcgaacaacaagggctcgaactcgcg
cacgcccatcagaatctcgaccggccgggtgccaacgaccccgaacgcgcgctgtcggac
atcctgatgcatttgcgcgtgcgcaccgggcacgacttccggctctacaagcgcgcgacc
gtgctgcgccggatcgaacggcgcatgcaggtcaacgggcagcgcgacctgctcgcgtac
cgcgatttcctgcgcgcgacacccgacgaggcgaacgcgctgctcgccgacatgctgatc
ggcgtcacgcagttcttccgcgatcgcgacgcgttcgacttcctcgaacgcgaggtgatc
gcgtcgatgttctcgccggatgccggcgaggaacaggtgcgcgtctgggtcgccggctgc
gcgacgggcgaggaggcgtattcgatctcgctgctgctcgcccgtgcgcgcgagacggcc
gtgtcgagccaggcgatccaggtgttcgcgaccgacatcgacgaagcggcgatcgtgcgc
gcgcgcaccggctcctatccgctgtcgatcgcagccgacgtgcccgaaccgctgctgcag
cggtatttcacgcgcgacggcgcgcatttcgtgattgcgaaatcggtgcgcgagcgcatt
ctgttcgccgcgcacagcctgctgcgcgatccgccgttctcgcatctcgatctgatctcg
tgccgcaacgtgctgatctacctcgaacgcgcggtgcagcggcagatcctcgagctgttt
cacttcgcgctgcgcccgaacggctatctgttcctcggcaccgccgaatcggccgacgcg
gccgacgatctgtttaccgtcgtcgacaagaagcgccgcatctatcaggcgcgcgtcgtc
acgcatcgcgcgaaaacgccgaccggttgcccgccgctgctgcacgtcgaatcgggttcg
gccgacgagcggcccgtgccgacgccggcgctgcgtgcgccggcgagcccggtccagcgc
aatttctcgtatgcggaactccatcaacgggcactggaaatgtattcgccgccgagcgtg
atcatcgacaaggaatcgaacgtcgtgcatctgtcggacaacgccggccgattcctgcgc
cacgtcggcggcgagctgtcgagcaacatcatgacgctcgtgctgcccgacctgcggctc
gacctgcgcaccgccatcttccgcgcgctgcagacgggcacgagcgtcgaggcgcgccgc
gtcaagtggacgcacgacacgcaggtgtcgtggatcaacatgacggtgcggccgtttcac
gacaaggttgcgaacgcggactttctgctcgtcgtgttcgacgaggtggccgggcgcatg
accgacgaggaccaggccgaagccaccgggcaggatccggtgctcgcgcagctcgagcac
gaactgcagcacagccgcgagcagctcgcgacgatcatcgagcagtatgaaacctcggtc
gaggaactgaaggcctcgaacgaggaactgcaggcgatcaacgaggagctgcgctcgacc
agcgaggagctcgaaagcagcaaggaagaactgcagtcggtgaacgaggagctgacgacc
gcgaacgccgagatgcaggcgcggatcgaggacaccgccaaggccaacgacgatctgcac
aacatcatcgcctcgagcgagatcgcgaccgtcttcgtcgacaaggaaatccgcatcaag
cgcttcacgccgaacgcgaccgcgatcttcaacctgatcgacagcgatctcggccgctcg
ctgtttcacatcacccattcgctgcgctatccgacgctcgccgacgacgtgcggcagtcg
ttccagtcgctgcggctgatcgaacgcgagatcgagagcgaggccgggcgctggtatctg
atccggttgctgccgtatcgcaccgccgacgaccatatcgacggcgccgtcatcacgctg
atcgacgtcacggatcgccatcacgcggaggaagccgcgcgggccggcgagcagcggctg
cgcctcgtcgcgcagtcgacgaaggactacgcgatcatcatccaggacggcaacggcatc
atcgcgagctggaatgcgggggccgaacggatcttcggctataccgaagacgaaatgatc
ggccaggacgtcgagctgatctacgagccgaacgaccggcatgcgcgcgtgccggcgcac
gagcgcgaggtcgcggcgcgcgaaggccgcgcggacgacgaacgctggcatcgcacgaag
gacgggcggcggatcttctgcagcggtgtcgtgacgccgattgccgatacgtcgttcaac
ggcttcgcgaagatcgtccgcgacctgacgcagcgcaagctcagcgaggacgcgaaccgc
gaagcgctcgcgcgcgagcaggccgcccgcgagcaggcgctcagttccaatcagctgaag
gacgagttcatcgccgtgctgtcgcacgaattgcggcatccgctgaacctgatcggcgtg
cgtgccgaaatgctgccgcgtctgcccgaaacgcgcgacatccccgcggtgcgcgaagcg
gccgagctgattcggcaggcggtacgcgcgcaggcgcagatcatcgacgatctgctcgat
ctgtcccgcatccgcaccggcaagctcgcgctcgagctgtcgcgcgtcgatctgacggcg
gtgctgcgcacgatcgtcgatacgtgcgaggcggacgcgcacgcgcgcggcctcgtgctg
accgccgagttgccggacgagccggcgattgcgctcgccgatccgatccgctgcgagcag
attttctggaacctgatgtcgaatgcgctgaagttcacgcatgcaggcggccggatcgtc
gtgcggctcacgcatgaagcgcggatgctgcgcgtcgacgtgatcgacgacggacaggga
atcgaccgcgacacgcttccgcacgtgttcgacatgttccgccaggcgccgcgcgaccgc
acgcgcggcgggctcggcatcgggctcgcgctcgtgcggcagctcgtcgaaatgcacgac
ggccgcatttcggcggcgtccgaggggcccgggcgcggcaccacgatgacggtgtggctg
ccggccgccgccgacacgcgcgtcgcggccgccgaccgccgcgcgtcggagggccgtatc
gcgggcctgcacgtgctgctcgtcgaggacgacgccgagaccgcgctgtcgctgactacc
ctgctgaaactggcgggcgcggaggtgcgcaccgcggcgagcggcgcagcggcgctggag
atgctcgcgcaaggccccgtcgatgcgatcgtgtccgatatcgggctgcccgacatggac
ggttacgcgctgctgcgccgaatcaaggccgatccgcaatgggcgcaggtgaaggcgatc
gcgctgacgggccgtaaccgtcagaccgacgtcggcgccgcgacccaagccggattcgac
acgcatctgccgaaaccgctcgatttcggcttgttgctcgcggccctcgccgaaccgcgc
tga

DBGET integrated database retrieval system