KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05336Help
Entry
BMULJ_05336       CDS       T00740                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMULJ_05336 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMULJ_05336 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMULJ_05336 (glcB)
Enzymes [BR:bmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BMULJ_05336 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2424685..2426859
Genome map
AA seq 724 aa AA seqDB search
MIDHDGLQVAPALSQFIENEALPGTGIDQAAFWRGFSALVHDLAPRNRELLAERDRLQSE
LDAWHRAHPGPVRDLAAYRAFLEQIGYLVPTPADVAATTANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDNGAERTATYNPTRGQRVIDYARNVLDNAAPLA
GASHRDALRYRVQDGQLAVETGKGIVHLAQPAQFVGYQGAADAPSAILLKHNGLHLEIQI
DGSTPIGRADVANVKDVVLEAAVSTIIDCEDSVAAVDAEDKVQLYRNWLGLMQGTLVEEV
SKGGKTFTRRLNADREYTTPDGGTLTLHGRSLLFVRNVGHLMTIGAVLDRDGNEIPEGIL
DGVVTTLCALHDLKSKRNSRTGSIYIVKPKMHGPAEVAFADTLFARIEDLYGLPRNTLKM
GIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHSAMEAGPMIRKGDMKSSAWI
AAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELERTPYASERDALLDGLLTVPVVERAAWSDEEILREVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPDYDRSVAFQAACALALHGTSQPSGYTEPLLHRFRLAFKAQ
QAQA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccatgacggactgcaagtcgcgccagcgctgagccagttcatcgaaaacgaa
gcgctgccgggcaccggcatcgaccaagccgcgttctggcgcggcttctccgcactggtg
cacgaccttgcgccgcgcaaccgcgaactgctcgccgagcgcgaccgtctgcaaagcgaa
ctcgacgcctggcatcgcgcgcaccccggcccggtgcgcgacctcgccgcgtatcgcgcg
ttcctcgagcagatcggctacctggtgccgacgccggccgacgtcgcggccacgaccgcg
aacgtcgacagcgaaatcgcgacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctatgcgctgaacgcggcgaacgcgcgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcgctgccggaagacaacggcgccgagcgcaccgcaacgtacaacccgacg
cgcggccagcgcgtgatcgactacgcgcgcaacgtgctcgacaacgcggcgccgctggcc
ggtgcgtcgcaccgcgacgcgctgcgctaccgcgtgcaggacggccagctcgccgtcgag
accggcaagggcatcgtgcacctcgcgcagcccgcgcaattcgtcggctaccagggcgcg
gccgatgcgccctccgcgatcctgctgaagcacaacgggctccatctcgagatccagatc
gacggctcgacgccgatcggccgcgcggacgtcgcgaacgtgaaggacgtcgtgctcgaa
gcggcggtcagcacgatcatcgactgcgaggattcggtcgcggccgtcgacgccgaggac
aaggtgcagctgtaccgcaactggctcgggctgatgcagggcacgctggtggaggaagtg
tcgaagggcggcaagacgttcacgcgccgcctgaacgcggaccgcgaatacacgacgccc
gacggcggcacgctgacgctgcacggccgctcgctgctgttcgtgcgcaacgtcgggcac
ctgatgacgatcggcgcggtgctcgatcgcgacggcaacgagattccggaaggcatcctc
gatggcgtcgtcacgacactctgcgcgctgcacgacctgaagtcgaagcgcaattcgcgc
accggctccatctacatcgtgaagccgaagatgcacggcccggccgaagtcgcgttcgcc
gatacgctattcgcgcgcatcgaggatctctacgggctgccgcgcaatacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcctgcatcgcggccgcc
gccgcgcgcgtcgcattcatcaacacgggcttcctcgatcgcaccggcgacgagatgcac
agcgcgatggaagcgggaccgatgatccgcaagggcgacatgaagtcgtccgcatggatc
gccgcgtacgagcgcaacaacgtgctcgccgggctgtcggccggactgcgtgggcgcgcg
cagatcggcaaggggatgtgggcgatgcccgacctgatgcacgcgatgctcgagcagaag
atcgcgcatccgcgcgcgggcgcgaacaccgcgtgggtgccctcgccgaccgccgcgacg
ctgcatgcgctgcactaccatctcgtcgacgtgcaggccgtccagcaggaactcgaaagg
acgccgtacgcgagcgagcgcgacgcgctgctcgacgggctgctgaccgtgccggtcgtc
gagcgtgccgcgtggagcgacgaagagatcctgcgcgaagtcgaaaacaacgcgcagggc
attctcggctacgtcgtgcggtgggtcgaacagggcgtcggctgctcgaaggtgccggac
atccacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcgagccagcacatc
gcgaactggctgcgtcacggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcgcgcgtcgtcgaccagcagaacgcgggcgacccgaactatcgtccgatggcgccc
gactacgaccggtcggtcgcgttccaggctgcctgcgcgctcgcgctgcacggcacgtcg
cagccgagcggctatacggagccgctgctgcaccggttccggcttgcgttcaaggcgcag
caggcacaggcctaa

DBGET integrated database retrieval system