KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05337Help
Entry
BMULJ_05337       CDS       T00740                                 

Definition
(GenBank) putative diguanylate cyclase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF dCache_1
Motif
Other DBs
NCBI-ProteinID: BAG47175
UniProt: A0A0H3KU76
Position
2:2427342..2428910
Genome map
AA seq 522 aa AA seqDB search
MAETDYAMPRESGLTSRVATHLRRLLLPHLIFYSGLLIALLLMLLCAIVLYEGRIDARER
ARTTLQNLVLMASWDIERNIEIYSLSLQAVVEGENDPAIVALPMPLRRQVLFDRATTARY
LGGIYVLDSRGNIAVDGKSDVPRNANFADAPYFSVHRDRPDVGLYVSDPYRSRLRGGSPS
IALSRRITRADGSFGGIAVMSIRLEYFRDLFSRLALGDRGAMSLIGTNGVMVMREPYDPK
IVGRNISQASTFRQFMRAREGSFFDRASIDGVRRLYAFRHLDNLPLIMMVAESESEIYAA
WYDRAIPIGSAMALLALGFVGLSLLLDVQLRKRHRAETELQALARTDGLTGLDNRRMLDV
TLAREWRRAARSQHALSLLFVDVDHFKRYNDSQGHQAGDDALAAVGRCIAGCLRRPADYA
ARYGGEEFVVILPDIGSDGAVAIAETIRTSILELGIRHDGSAFGCLTASIGVATCRPDRD
DDMHAALKLADDALYRAKETGRNRVVVLTAAHAGRHYAPRTA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaccgactacgcaatgccccgcgaatccggcctgacgagccgcgtcgcgacg
cacctgcgccggctgctgctgccgcacctgatcttctattccggcctgctgatcgcgctg
ctgctaatgctgctgtgcgccatcgtgctctacgaaggccgcatcgatgcgcgcgagcgc
gcacgcacgacgctgcagaatctcgtgctgatggcatcgtgggacatcgagcgcaacatc
gagatctattcgctgtcgctgcaggccgtcgtcgaaggcgaaaacgatccggcgatcgtc
gcgctgccgatgccgttgcgccggcaggtgctgttcgaccgcgcgacgaccgcacgctat
ctcggcggcatctacgtgctcgacagccgcggcaacatcgcggtcgacggcaagagcgac
gtgccgcgcaacgcgaatttcgccgacgcgccgtacttcagcgtgcaccgcgaccggccc
gacgtcggcctctacgtcagcgatccgtaccgctcgcggctgcgcggcggctcgccgagc
atcgcgctcagccgccgcatcacgcgcgcggacggctcgttcggcggcatcgccgtgatg
tcgatccggctcgaatatttccgcgacctgttctcgcgcctggcgctcggcgatcgcggc
gcgatgtcgctgatcggtacgaacggcgtgatggtgatgcgcgagccgtacgacccgaag
atcgtcggccgcaacatcagtcaggcgagcacgttccgtcagttcatgcgtgcgcgcgaa
ggcagctttttcgacagggcgtcgatcgacggcgtgcggcggctgtatgcgttccggcac
ctcgacaacctgccgctgatcatgatggtggccgaatccgagtcggagatctacgcggcc
tggtacgaccgcgcgatcccgatcggttcggcgatggcgctgctcgcgctcggtttcgtc
ggcctgtcgctgctgctcgacgtgcagttgcgcaagcgccatcgcgcggagaccgagctg
caggcgctcgcccgcaccgacggcctgaccggcctcgacaaccgccggatgctcgacgtg
acgctcgcgcgcgaatggcggcgcgccgcgcgctcgcagcacgcgctgtcgctgctgttc
gtcgacgtcgatcacttcaagcgctacaacgactcgcagggccatcaggccggcgacgac
gcgctggcggcggtcggccgctgcatcgccggctgcctgcgccgcccggccgactatgcc
gcccgctacggcggcgaggaattcgtcgtgatcctgcccgatatcggcagcgacggcgcg
gtggccatcgcggagacgatccgcacgagcattctcgaactcgggatccggcacgacggc
agcgcgttcggctgcctgaccgcgagcatcggcgtcgcgacctgccggccggaccgcgac
gacgacatgcacgccgcgctcaagctcgccgacgacgcgctgtaccgcgcgaaggaaacc
ggccgcaaccgcgtcgtcgtgctcacggccgcgcacgcgggccgccattacgcgccgcgc
acggcctga

DBGET integrated database retrieval system