KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05338Help
Entry
BMULJ_05338       CDS       T00740                                 

Definition
(GenBank) two-component system sensor kinase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_2 dCache_2 Cache_3-Cache_2 HisKA_3 HATPase_c HATPase_c_2 DUF5115 dCache_1
Motif
Other DBs
NCBI-ProteinID: BAG47176
UniProt: A0A0H3KQ28
Position
2:2429028..2430407
Genome map
AA seq 459 aa AA seqDB search
MKLKAKIFLLAIVPFLLAIAGIGFGVRQQATSLARTQHATIQAAYLSSKEVELKHYVELA
TSAIMPLYDAAGRNGRDDAMLRTQALAMLQKMDFGPDGYFFVYDLHGNALMHPREPERVG
HNFWTMRDPQGALTIQQLIGAASRGGGFVRYVWQRPSTGKPAPKLGYVVALERWGWMVGT
GIYLDDVDTALQRIDARASANIERTMSWLTAIALTGAAAIAVCALVLNVSESRSADAKLK
QLAQRVVESQEQERARLSRELHDGISQMMVSAKLMLESALARFERGTVRVPEAERALASG
VVRLGDTLREVRRISHALRPAMLDDLGLAAALDQLIREFGAQSGIDIGYTQVAHSGARPL
PAAVNTALFRIAQEALSNIVHHAHASRAAVTLDVGAQSVTLTIADNGCGFDAVRSQADER
RGIGLRNMRERLDALGGTLTITSQVGHTVVAARVPLRDA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaggccaagattttcctgctggcgatcgtgccgttcctgctcgcgatcgcc
ggaatcggtttcggcgtgcgccagcaggcgacgtcgctcgcgcgcacgcagcatgcgacg
atccaggccgcgtatctgtcgagcaaggaagtcgagctgaagcactacgtcgagctcgcg
acgagcgcgatcatgccgctgtacgacgcggccggccgcaacgggcgcgacgacgcgatg
ctgcgcacgcaggcgctcgcgatgctgcagaagatggatttcggcccggacggctatttc
ttcgtgtacgacctgcacggcaacgcgctgatgcatccgcgcgagcccgagcgcgtcggc
cataacttctggaccatgcgcgacccgcagggcgcgctgacgatccagcagctgatcggc
gccgcctcgcgcggcggcggcttcgtgcgctacgtctggcagcggccgtcgaccggcaag
ccggcgccgaagctcggctacgtggtcgcgctcgaacgctggggctggatggtaggcacc
ggcatctatctcgacgacgtcgacaccgcactgcagcggatcgacgcccgcgcttccgcg
aacatcgagcgcacgatgagctggctgaccgcgatcgcgctcaccggcgccgcggcgatc
gccgtctgcgcgctggtgctgaacgtcagcgagtcgcgcagcgccgatgcgaagctcaag
cagctcgcgcagcgcgtcgtcgaatcgcaggagcaggagcgcgcgcggctgtcgcgcgag
ctgcacgacgggatcagtcagatgatggtgtccgcgaagctgatgctcgaatcggcgctc
gcgcgcttcgagcgcggcacggtgcgcgtgccggaagccgagcgcgcgctcgcgtccggc
gtcgtgcggctcggcgacacgctgcgcgaggtgcgccgcatctcgcacgcgctgcgcccg
gcgatgctcgacgatctcggcctcgcggcggcgctcgatcagctgatccgcgaattcggc
gcgcaaagcggcatcgacatcggctacacgcaggtcgcgcacagcggcgcgcggccgctg
cccgcagccgtgaacaccgcgctgttccggatcgcgcaggaagcgctcagcaacatcgtg
catcatgcgcacgcgtcgcgcgcggccgtcacgctcgacgtcggcgcgcagtcggtcacg
ctgacgatcgccgacaacggctgcggcttcgacgccgtgcgctcgcaggccgacgagcgc
cgcggcatcgggctgcgcaacatgcgcgagcgcctcgacgcgctcggcggcacgctgacg
atcacgtcgcaggtcggccacaccgtcgtggccgcgcgcgtgccgctacgcgacgcgtga

DBGET integrated database retrieval system