KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05339Help
Entry
BMULJ_05339       CDS       T00740                                 

Gene name
narL
Definition
(GenBank) two-component system nitrate/nitrite response regulator
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 HTH_29 HTH_24 HTH_40 Sigma70_r4 HTH_20 HTH_11 HTH_38 HTH_Tnp_ISL3 HTH_28 HTH_36
Motif
Other DBs
NCBI-ProteinID: BAG47177
UniProt: A0A0H3KXN7
Position
2:2430435..2431079
Genome map
AA seq 214 aa AA seqDB search
MSAPDTARPAARLLLVDDHPLVRDGLRMRLEAADLSVVGEAGNADEALALAAELEPDLAL
MDVGMNGMNGIALAGVFHERFPAIRVLMLSMHDNVEYVTQAVRAGASGYLLKDSPASEIV
RAIGAVLAGQTFFSEGLAARMIQASAAASPLDRLTPRERDILDALAEGLSSKQIAQQTGL
SVRTVETHRLNLKRKLDIEGQAELIKFAVEHRRR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccccgacaccgcccgacccgccgcccggctgctgctcgtcgacgatcatccg
ctcgtgcgcgacgggctgcgcatgcggctcgaagcggccgatctgtccgtggtcggcgaa
gccggcaacgccgacgaggcgcttgcgctcgcggccgaactcgagcccgatctcgcgctg
atggacgtcggcatgaacgggatgaacggcatcgcgctggccggcgtgttccacgagcgg
tttccggcgatccgcgtgctgatgctctcgatgcacgacaacgtcgaatatgtgacgcaa
gccgtgcgggcgggcgcgagcggctatctgctgaaggattcgccggccagcgagatcgtg
cgcgcgatcggcgcggtgctcgcggggcaaaccttcttcagcgaggggctcgccgcacgg
atgatccaggcgagcgcggccgcgtcgccgctcgaccggctgacgccgcgcgaacgcgac
atcctcgatgcgctcgccgaagggctgtcgagcaagcagatcgcacagcagacggggttg
tcggtgcgcacggtggaaacgcaccggctcaatctgaaacgcaagctcgacatcgaaggg
caggccgaactgatcaagttcgcggtcgagcatcggcggcgctag

DBGET integrated database retrieval system