KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05340Help
Entry
BMULJ_05340       CDS       T00740                                 

Definition
(GenBank) putative ABC-type transport system auxiliary component
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaC
Motif
Other DBs
NCBI-ProteinID: BAG47178
UniProt: A0A0H3KPM6
Position
2:complement(2431252..2431848)
Genome map
AA seq 198 aa AA seqDB search
MKRHLFAFLAAAAVSVSAFAQSAPVDIVRHAVEGTVNAMKADPAARGGDMAKITQVVEQR
FLPATNFERTTRIAVGDAWKQATPQQQQELYKQFRLLMTRTYAASLAQLGNQDAKFSFKA
GGTSGADALVQSTVTTPGDSQSVGYRLGKVGNDWKIYDIDMSGAWLIQVYQGQFKSQLAS
GGIDGLIAYLQKHNSRTN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtcatctgtttgctttcctcgccgcggccgccgtgtcggtttccgctttcgcg
cagagcgcgccggtcgacatcgtccgccatgcggtcgaaggcaccgtcaatgcgatgaag
gccgatccggccgcgcgcggcggcgacatggcaaagatcacgcaggtcgtcgagcagcgc
ttcctgcccgcgacgaacttcgagcgcacgacgcgcatcgcggtcggcgacgcgtggaag
caggcgacgccgcaacagcagcaggagctctacaagcagttccggctgctgatgacgcgc
acgtacgccgcgtcgctcgcgcagctcggcaaccaggacgcgaagttctcgttcaaggcg
ggcggcacgtcgggcgccgacgcgctcgtgcagtcgacggtcacgacgccgggcgacagc
cagtcggtcggctaccggctcggcaaggtcggcaacgactggaagatctacgacatcgac
atgtccggtgcgtggctgatccaggtctatcaggggcagttcaagagccagctcgcgtcg
ggcggcatcgacggcctgatcgcgtatctgcagaagcacaattcccgcacgaactga

DBGET integrated database retrieval system