KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05344Help
Entry
BMULJ_05344       CDS       T00740                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(2439818..2440759)
Genome map
AA seq 313 aa AA seqDB search
MKGISSATQSDSAPKIVSAKRTSAPPRQPNGTFLSNRDPRQQPGPRRNRPFGPLAPPEDE
PTRLAAVLGHRNALLEAGRVLLRALVDMSALIDTGHDARLRDLLLEEVRVFERLCVRANI
RVDHRIGARYCLCTALDEAAMRELAARGDASGSAAWASDALTQRIGEDNQGGSKVYALTL
RLLDDAADHWPLLELIYRIFSLGFEGRYPHGRTFSAHDRVRERIYNAIAAHLPTVPNALS
PHAATIESARPRACFEMPVWLSAAVLSAALCALYVYCRIESGAQADDVQRQLSNIARTAP
YSAIDPPQGDPAR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaatttcgagcgcgacgcaatccgatagcgcacccaaaatcgtgtcggcgaag
cgcacgtccgcgccaccgcgacagccaaacggcacgttcctctcaaacagggatccacga
cagcaacccggcccgcgccgtaatcgtccattcgggccacttgcgccgcccgaagacgaa
ccgacgagactggcagcggtacttggccaccgtaacgccttgctggaagcgggcagggtg
ctgcttcgggcgttggtcgacatgtccgcattgatcgacaccggccatgacgcacgcctg
cgcgacctgctgctggaagaagtccgcgtattcgagcgcctgtgcgtacgggccaacatt
cgcgtggaccacaggatcggcgcccgatattgcctatgcactgcactggacgaagctgca
atgcgcgaacttgcggcgcgcggcgacgcgtcgggaagcgctgcatgggcgtcagacgcg
ctgactcaacggatcggcgaggataaccagggcggctcgaaggtctacgcgcttacgctg
cgcctgctcgatgacgccgccgaccattggccgttgctcgaactgatctaccggattttc
agcctggggtttgaaggccggtatccgcatggccggacgttcagcgcgcacgaccgcgta
cgagagcgaatctacaacgcgattgcggcgcatctgcccaccgtcccgaacgcgctgtcg
ccccacgccgcgacgatcgaatcggcgcgaccgagagcctgtttcgaaatgccggtgtgg
ctgtcggcggccgtgctgtcagcggcgctctgcgcgctgtatgtctattgccgcatcgag
tcgggcgcgcaagccgacgacgtgcagcgccaactttccaacatcgcgcgcaccgcgcca
tacagcgcgatcgacccgccgcagggcgatccggcgcgctag

DBGET integrated database retrieval system